Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAQRTLIRVTPEQPTHAVCVLGTLTQLDICSSAPEDCTSFSINASPGVVV DIAHSPPAKKKSTGSSTWPLDPGVEVTLTMKAASGSTGDQKVQISYYGPK TPPVKALLYLTAVEISLCADITRTGKVKPTRAVKDQRTWTWGPCGQGAIL LVNCDRDNLESSAMDCEDDEVLDSEDLQDMSLMTLSTKTPKDFFTNHTLV LHVARSEMDKVRVFQATRGKLSSKCSVVLGPKWPSHYLMVPGGKHNMDFY VEALAFPDTDFPGLITLTISLLDTSNLELPEAVVFQDSVVFRVAPWIMTP NTQPPQEVYACSIFENEDFLKSVTTLAMKAKCKLTICPEEENMDDQWMQD EMEIGYIQAPHKTLPVVFDSPRNRGLKEFPIKRVMGPDFGYVTRGPQTGG ISGLDSFGNLEVSPPVTVRGKEYPLGRILFGDSCYPSNDSRQMHQALQDF LSAQQVQAPVKLYSDWLSVGHVDEFLSFVPAPDRKGFRLLLASPRSCYKL FQEQQNEGHGEALLFEGIKKKKQQKIKNILSNKTLREHNSFVERCIDWNR ELLKRELGLAESDIIDIPQLFKLKEFSKAEAFFPNMVNMLVLGKHLGIPK PFGPVINGRCCLEEKVCSLLEPLGLQCTFINDFFTYHIRHGEVHCGTNVR RKPFSFKWWNMVP
    • Amino acids
      1 to 663
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161695 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • EC 3.5.3.15
    • HL 60 PAD
    • HL-60 PAD
    • PAD
    • PAD 4
    • PADI 4
    • PADI 5
    • PADI H protein
    • Padi4
    • PADI4_HUMAN
    • PADI5
    • PDI 4
    • PDI 5
    • PDI4
    • PDI5
    • Peptidyl arginine deiminase type IV
    • Peptidyl arginine deiminase type V
    • Peptidylarginine deiminase IV
    • Protein arginine deiminase
    • Protein arginine deiminase type 4
    • Protein arginine deiminase type IV
    • Protein-arginine deiminase type IV
    • Protein-arginine deiminase type-4
    see all
  • Function
    Catalyzes the citrullination/deimination of arginine residues of proteins. Citrullinates histone H3 at 'Arg-8' and/or 'Arg-17' and histone H4 at 'Arg-3', which prevents their methylation by CARM1 and HRMT1L2/PRMT1 and represses transcription. Citrullinates EP300/P300 at 'Arg-2142', which favors its interaction with NCOA2/GRIP1.
  • Tissue specificity
    Expressed in eosinophils and neutrophils, not expressed in peripheral monocytes or lymphocytes.
  • Involvement in disease
    Genetic variations in PADI4 are a cause of susceptibility to rheumatoid arthritis (RA) [MIM:180300]. It is a systemic inflammatory disease with autoimmune features and a complex genetic component. It primarily affects the joints and is characterized by inflammatory changes in the synovial membranes and articular structures, widespread fibrinoid degeneration of the collagen fibers in mesenchymal tissues, and by atrophy and rarefaction of bony structures. Note=Could have an important role in the pathogenesis of rheumatoid arthritis by increasing citrullination of proteins in rheumatoid arthritis synovial tissues, leading, in a cytokine-rich milieu, to a break in tolerance to citrullinated peptides processed and presented in the appropriate HLA context.
  • Sequence similarities
    Belongs to the protein arginine deiminase family.
  • Cellular localization
    Cytoplasm. Nucleus. Cytoplasmic granule. Cytoplasmic granules of eosinophils and neutrophils.
  • Information by UniProt

Images

  • ab161695 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161695 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161695.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up