Overview

Description

  • Nature
    Recombinant
  • Source
    Baculovirus infected Sf9 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MAQGTLIRVTPEQPTHAVCVLGTLTQLDICSSAPEDCTSFSINASPGVVV DIAHGPPAKK KSTGSSTWPLDPGVEVTLTMKVASGSTGDQKVQISYYG PKTPPVKALLYLTGVEISLCAD ITRTGKVKPTRAVKDQRTWTWGPCGQ GAILLVNCDRDNLESSAMDCEDDEVLDSEDLQDM SLMTLSTKTPKDFF TNHTLVLHVARSEMDKVRVFQATRGKLSSKCSVVLGPKWPSHYLMV PG GKHNMDFYVEALAFPDTDFPGLITLTISLLDTSNLELPEAVVFQDSVVFR VAPWIMTP NTQPPQEVYACSIFENEDFLKSVTTLAMKAKCKLTICPEE ENMDDQWMQDEMEIGYIQAP HKTLPVVFDSPRNRGLKEFPIKRVMGPD FGYVTRGPQTGGISGLDSFGNLEVSPPVTVRG KEYPLGRILFGDSCYP SNDSRQMHQALQDFLSAQQVQAPVKLYSDWLSVGHVDEFLSFVP APDR KGFRLLLASPRSCYKLFQEQQNEGHGEALLFEGIKKKKQQKIKNILSNKT LREHNS FVERCIDWNRELLKRELGLAESDIIDIPQLFKLKEFSKAEAF FPNMVNMLVLGKHLGIPK PFGPVINGRCCLEEKVCSLLEPLGLQCTFI NDFFTYHIRHGEVHCGTNVRRKPFSFKWWN MVP
    • Molecular weight
      75 kDa including tags
    • Amino acids
      1 to 663
    • Tags
      DDDDK tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab196393 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Specific activity of ≥80 pmole/min/µg.

  • Applications

    SDS-PAGE

    Functional Studies

  • Purity
    >= 65 % SDS-PAGE.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.63% Tris HCl, 0.64% Sodium chloride, 0.02% Potassium chloride, 0.462% DTT, 20% Glycerol

    Also contains 80 µg/ml DYKDDDDK peptide.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • EC 3.5.3.15
    • HL 60 PAD
    • HL-60 PAD
    • PAD
    • PAD 4
    • PADI 4
    • PADI 5
    • PADI H protein
    • Padi4
    • PADI4_HUMAN
    • PADI5
    • PDI 4
    • PDI 5
    • PDI4
    • PDI5
    • Peptidyl arginine deiminase type IV
    • Peptidyl arginine deiminase type V
    • Peptidylarginine deiminase IV
    • Protein arginine deiminase
    • Protein arginine deiminase type 4
    • Protein arginine deiminase type IV
    • Protein-arginine deiminase type IV
    • Protein-arginine deiminase type-4
    see all
  • Function
    Catalyzes the citrullination/deimination of arginine residues of proteins. Citrullinates histone H3 at 'Arg-8' and/or 'Arg-17' and histone H4 at 'Arg-3', which prevents their methylation by CARM1 and HRMT1L2/PRMT1 and represses transcription. Citrullinates EP300/P300 at 'Arg-2142', which favors its interaction with NCOA2/GRIP1.
  • Tissue specificity
    Expressed in eosinophils and neutrophils, not expressed in peripheral monocytes or lymphocytes.
  • Involvement in disease
    Genetic variations in PADI4 are a cause of susceptibility to rheumatoid arthritis (RA) [MIM:180300]. It is a systemic inflammatory disease with autoimmune features and a complex genetic component. It primarily affects the joints and is characterized by inflammatory changes in the synovial membranes and articular structures, widespread fibrinoid degeneration of the collagen fibers in mesenchymal tissues, and by atrophy and rarefaction of bony structures. Note=Could have an important role in the pathogenesis of rheumatoid arthritis by increasing citrullination of proteins in rheumatoid arthritis synovial tissues, leading, in a cytokine-rich milieu, to a break in tolerance to citrullinated peptides processed and presented in the appropriate HLA context.
  • Sequence similarities
    Belongs to the protein arginine deiminase family.
  • Cellular localization
    Cytoplasm. Nucleus. Cytoplasmic granule. Cytoplasmic granules of eosinophils and neutrophils.
  • Information by UniProt

Images

  • Enzyme reaction was performed in a buffer (50 mM Tris, pH 7.4, 50 mM NaCl, 10 mM CaCl2, and 2 mM DTT) containing ab196393 and 10 mM BAEE as a substrate for 25 min at 37°C. Amount of ammonia produced was measured and used for specific activity calculation.

  • 10% SDS PAGE with Coomassie staining: 2.4 µg ab196393.

References

This product has been referenced in:
  • Yuzhalin AE  et al. Colorectal cancer liver metastatic growth depends on PAD4-driven citrullination of the extracellular matrix. Nat Commun 9:4783 (2018). Read more (PubMed: 30429478) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab196393.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up