Recombinant Human PADI4 / PAD4 protein (BSA and azide free) (ab173032)

Description

  • Product name

    Recombinant Human PADI4 / PAD4 protein (BSA and azide free)
    See all PADI4 / PAD4 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MAQGTLIRVTPEQPTHAVCVLGTLTQLDICSSAPEDCTSFSINASPGVVV DIAHGPPAKKKSTGSSTWPLDPGVEVTLTMKVASGSTGDQKVQISYYGPK TPPVKALLYLTGVEISLCADITRTGKVKPTRAVKDQRTWTWGPCGQGAIL LVNCDRDNLESSAMDCEDDEVLDSEDLQDMSLMTLSTKTPKDFFTNHTLV LHVARSEMDKVRVFQATRGKLSSKCSVVLGPKWPSHYLMVPGGKHNMDFY VEALAFPDTDFPGLITLTISLLDTSNLELPEAVVFQDSVVFRVAPWIMTP NTQPPQEVYACSIFENEDFLKSVTTLAMKAKCKLTICPEEENMDDQWMQD EMEIGYIQAPHKTLPVVFDSPRNRGLKEFPIKRVMGPDFGYVTRGPQTGG ISGLDSFGNLEVSPPVTVRGKEYPLGRILFGDSCYPSNDSRQMHQALQDF LSAQQVQAPVKLYSDWLSVGHVDEFLSFVPAPDRKGFRLLLASPRSCYKL FQEQQNEGHGEALLFEGIKKKKQQKIKNILSNKTLREHNSFVERCIDWNR ELLKRELGLAESDIIDIPQLFKLKEFSKAEAFFPNMVNMLVLGKHLGIPK PFGPVINGRCCLEEKVCSLLEPLGLQCTFINDFFTYHIRHGEVHCGTNVR RKPFSFKWWNMVP
    • Predicted molecular weight

      76 kDa
    • Amino acids

      1 to 663
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab173032 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.50
    Constituents: 0.605% Tris, 2.92% Sodium chloride

    Supplied as a 0.2 µm Ø filtered solution.

General Info

  • Alternative names

    • EC 3.5.3.15
    • HL 60 PAD
    • HL-60 PAD
    • PAD
    • PAD 4
    • PADI 4
    • PADI 5
    • PADI H protein
    • Padi4
    • PADI4_HUMAN
    • PADI5
    • PDI 4
    • PDI 5
    • PDI4
    • PDI5
    • Peptidyl arginine deiminase type IV
    • Peptidyl arginine deiminase type V
    • Peptidylarginine deiminase IV
    • Protein arginine deiminase
    • Protein arginine deiminase type 4
    • Protein arginine deiminase type IV
    • Protein-arginine deiminase type IV
    • Protein-arginine deiminase type-4
    see all
  • Function

    Catalyzes the citrullination/deimination of arginine residues of proteins. Citrullinates histone H3 at 'Arg-8' and/or 'Arg-17' and histone H4 at 'Arg-3', which prevents their methylation by CARM1 and HRMT1L2/PRMT1 and represses transcription. Citrullinates EP300/P300 at 'Arg-2142', which favors its interaction with NCOA2/GRIP1.
  • Tissue specificity

    Expressed in eosinophils and neutrophils, not expressed in peripheral monocytes or lymphocytes.
  • Involvement in disease

    Genetic variations in PADI4 are a cause of susceptibility to rheumatoid arthritis (RA) [MIM:180300]. It is a systemic inflammatory disease with autoimmune features and a complex genetic component. It primarily affects the joints and is characterized by inflammatory changes in the synovial membranes and articular structures, widespread fibrinoid degeneration of the collagen fibers in mesenchymal tissues, and by atrophy and rarefaction of bony structures. Note=Could have an important role in the pathogenesis of rheumatoid arthritis by increasing citrullination of proteins in rheumatoid arthritis synovial tissues, leading, in a cytokine-rich milieu, to a break in tolerance to citrullinated peptides processed and presented in the appropriate HLA context.
  • Sequence similarities

    Belongs to the protein arginine deiminase family.
  • Cellular localization

    Cytoplasm. Nucleus. Cytoplasmic granule. Cytoplasmic granules of eosinophils and neutrophils.
  • Information by UniProt

References

ab173032 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab173032.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up