Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MLCLLLTLGVALVCGVPAMDIPQTKQDLELPKLAGTWHSMAMATNNISLM ATLKAPLRVHITSLLPTPEDNLEIVLHRWENNSCVEKKVLGEKTENPKKF KINYTVANEATLLDTDYDNFLFLCLQDTTTPIQSMMCQYLARVLVEDDEI MQGFIRAFRPLPRHLWYLLDLKQMEEPCRF
    • Molecular weight

      46 kDa including tags
    • Amino acids

      1 to 180

Specifications

Our Abpromise guarantee covers the use of ab114684 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.

    Previously labelled as Placental Protein 14 / Glycodelin A. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Alpha uterine protein
    • gD
    • GdA
    • GdF
    • GdS
    • Glycodelin
    • Glycodelin A
    • Glycodelin F
    • Glycodelin S
    • MGC138509
    • MGC142288
    • PAEG
    • PAEP
    • PAEP_HUMAN
    • PEG
    • PEP
    • Placental protein 14
    • Placental Protein 14 / Glycodelin A
    • PP14
    • Pregnancy-associated endometrial alpha-2 globulin
    • Progestagen-associated endometrial protein
    • Progesterone-associated endometrial protein
    see all
  • Function

    This protein is, quantitatively, the main protein synthesized and secreted in the endometrium from mid-luteal phase of the menstrual cycle and during the first semester of pregnancy.
  • Sequence similarities

    Belongs to the calycin superfamily. Lipocalin family.
  • Post-translational
    modifications

    At least two differentially glycosylated forms are found. Glycodelin-A (GdA) (amniotic fluid) with contraceptive and immunosuppressive activities and glycodelin-S (Gds) (seminal plasma) whose role is not yet known. The gender-specific glycosylation may serve to regulate key process involved in human reproduction.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • ab114684 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References

ab114684 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114684.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up