Overview

  • Product name

    Recombinant Human PAFAH2 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSMGVNQSVGFPPVTGPHLVGCGDVMEGQ NLQGSFFRLFYPCQKAEETMEQPLWIPRYEYCTGLAEYLQFNKRCGGLLF NLAVGSCRLPVSWNGPFKTKDSGYPLIIFSHGLGAFRTLYSAFCMELASR GFVVAVPEHRDRSAATTYFCKQAPEENQPTNESLQEEWIPFRRVEEGEKE FHVRNPQVHQRVSECLRVLKILQEVTAGQTVFNILPGGLDLMTLKGNIDM SRVAVMGHSFGGATAILALAKETQFRCAVALDAWMFPLERDFYPKARGPV FFINTEKFQTMESVNLMKKICAQHEQSRIITVLGSVHRSQTDFAFVTGNL IGKFFSTETRGSLDPYEGQEVMVRAMLAFLQKHLDLKEDYNQWNNLIEGI GPSLTPGAPHHLSSL
    • Molecular weight

      46 kDa including tags
    • Amino acids

      1 to 392
    • Tags

      His tag N-Terminus
    • Additional sequence information

      NP_000428.

Specifications

Our Abpromise guarantee covers the use of ab202608 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Purity

    > 90 % SDS-PAGE.
    ab202608 was purified by conventional chromatography techniques
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 20% Glycerol, 79% PBS, 0.02% DTT

General Info

  • Alternative names

    • EC 3.1.1.47
    • HSD PLA2
    • HSDPLA2
    • Platelet activating factor acetylhydrolase 2
    • Platelet activating factor acetylhydrolase 2 cytoplasmic
    • platelet-activating factor acetylhydrolase 2, 40kDa
    • SD PLA2
    • Serine dependent phospholipase A2
    see all
  • Relevance

    PAFAH2 is a single-subunit intracellular enzyme that catalyzes the removal of the acetyl group at the SN-2 position of platelet-activating factor (identified as 1-O-alkyl-2-acetyl-sn-glyceryl-3-phosphorylcholine).
  • Cellular localization

    Cytoplasmic

Images

  • 15% SDS-PAGE analysis of ab202608 (3 μg).

References

ab202608 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab202608.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up