Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MSNNGLDIQDKPPAPPMRNTSTMIGAGSKDAGTLNHGSKPLPPNPEEKKK KDRFYRSILPGDKTNKKKEKERPEISLPSDFEHTIHVGFDAVTGEFTGMP EQWARLLQTSNITKSEQKKNPQAVLDVLEFYNSKKTSNSQKYMSFTDKSA EDYNSSNALNVKAVSETPAVPPVSEDEDDDDDDATPPPVIAPRPEHTKSV YTRSVIEPLPVTPTRDVATSPISPTENNTTPPDALTRNTEKQKKKPKMSD EEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIKQ MNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGG SLTDVVTETCMDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMD GSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSL GIMAIEMIEGEPPYLNENPLRALYLIATNGTPELQNPEKLSAIFRDFLNR CLEMDVEKRGSAKELLQHQFLKIAKPLSSLTPLIAAAKEATKNNH
    • Molecular weight
      77 kDa including tags
    • Amino acids
      1 to 545
    • Additional sequence information
      N-terminal 6xHis-SUMO-tagged.

Specifications

Our Abpromise guarantee covers the use of ab238241 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    > 90 % SDS-PAGE.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names
    • ADRB2
    • Alpha PAK
    • Alpha-PAK
    • MGC130000
    • MGC130001
    • p21 activated kinase 1
    • p21 protein (Cdc42/Rac) activated kinase 1
    • p21-activated kinase 1
    • p21/Cdc42/Rac1 activated kinase 1 (yeast Ste20 related)
    • p21/Cdc42/Rac1-activated kinase 1 (STE20 homolog, yeast)
    • p65 PAK
    • p65-PAK
    • P68-PAK
    • PAK alpha
    • PAK-1
    • Pak1
    • PAK1_HUMAN
    • Paka
    • PAKalpha
    • Protein kinase MUK2
    • Rac/p21-activated kinase
    • Serine/threonine-protein kinase PAK 1
    • STE20 homolog yeast
    see all
  • Function
    The activated kinase acts on a variety of targets. Likely to be the GTPase effector that links the Rho-related GTPases to the JNK MAP kinase pathway. Activated by CDC42 and RAC1. Involved in dissolution of stress fibers and reorganization of focal complexes. Involved in regulation of microtubule biogenesis through phosphorylation of TBCB. Activity is inhibited in cells undergoing apoptosis, potentially due to binding of CDC2L1 and CDC2L2.
  • Sequence similarities
    Belongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. STE20 subfamily.
    Contains 1 CRIB domain.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications
    Autophosphorylated when activated by CDC42/p21 and RAC1.
  • Cellular localization
    Cytoplasm. Cell junction > focal adhesion. Recruited to focal adhesions upon activation.
  • Information by UniProt

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel analysis of ab238241.

References

ab238241 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab238241.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up