Overview

  • Product name

    Recombinant Human PAMCI protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MAPFGRNLLKTRHKNRSPTKDMDSEEKEIVVWVCQEEKLVCGLTKRTTSA DVIQALLEEHEATFGEKRFLLGKPSDYCIIEKWRGSERVLPPLTRILKLW KAWGDEQPNMQFVLVKADAFLPVPLWRTAEAKLVQNTEKLWELSPANYMK TLPPDKQKRIVRKTFRKLAKIKQDTVSHDRDNMETLVHLIISQDHTIHQQ VKRMKELDLEIEKCEAKFHLDRVENDGENYVQDAYLMPSFSEVEQNLDLQ YEENQTLEDLSESDGIEQLEERLKYYRILIDKLSAEIEKEVKSVCIDINE DAEGEAASELESSNLESVKCDLEKSMKAGLKIHSHLSGIQKEIKYSDSLL QMKAKEYELLAKEFNSLHISNKDGCQLKENRAKESEVPSSNGEIPPFTQR VFSNYTNDTDSDTGISSNHSQDSETTVGDVVLLST
    • Molecular weight

      74 kDa including tags
    • Amino acids

      1 to 435

Specifications

Our Abpromise guarantee covers the use of ab131813 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form

    Liquid
  • Additional notes

    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • P CIP1
    • P-CIP1
    • PAM COOH-terminal interactor protein 1
    • PCIP
    • Peptidylglycine alpha amidating monooxygenase COOH terminal interactor
    • peptidylglycine alpha-amidating monooxygenase COOH terminal interactor protein 1
    • Peptidylglycine alpha-amidating monooxygenase COOH-terminal interactor
    • Ras association (RalGDS/AF 6) domain family (N terminal) member 9
    • Ras association domain-containing protein 9
    • RASF9_HUMAN
    • Rassf9
    see all
  • Function

    May play a role in regulating vesicuar trafficking in cells.
  • Sequence similarities

    Contains 1 Ras-associating domain.
  • Cellular localization

    Endosome. Accumulates on perinuclear endosomes.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab131813 stained with Coomassie Blue.

References

ab131813 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab131813.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up