Description

  • Product name

    Recombinant Human Pan3 protein
  • Expression system

    Wheat germ
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      ENLQKAMELVTINYSSDLKNLILYLLTDQNRMRSVNDIMPMIGARFYTQL DAAQMRNDVIEEDLAKEVQNGRLFRLLAKLGTINERPEFQKDPTWSETGD RYLLKLFR
    • Amino acids

      508 to 615
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab166056 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • hPan3
    • PAB dependent poly(A) specific ribonuclease subunit 3
    • PAB-dependent poly(A)-specific ribonuclease subunit 3
    • PAB1P dependent poly(A) nuclease
    • PABP dependent poly(A) nuclease 3
    • PABP1 dependent poly A specific ribonuclease subunit PAN3
    • Pan 3
    • PAN deadenylation complex subunit 3
    • PAN3
    • PAN3 poly(A) specific ribonuclease subunit
    • PAN3 poly(A) specific ribonuclease subunit homolog
    • PAN3 polyA specific ribonuclease subunit homolog
    • PAN3_HUMAN
    see all
  • Function

    Functions in cytoplasmic mRNA decay. As part of the Pan nuclease complex, recruits polyadenylate-binding protein which in turn stimulates PAN2 nuclease activity.
  • Sequence similarities

    Belongs to the protein kinase superfamily.
    Contains 1 protein kinase domain.
  • Domain

    The protein kinase domain is predicted to be catalytically inactive.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • ab166056 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab166056 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab166056.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up