Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MKFFLLLFTIGFCWAQYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPK GFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTR CNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWD FNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNH LIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVI DLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWG FVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGF TRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCE HRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWS FSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAED PFIAIHAESKL
    • Amino acids
      1 to 511
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab157887 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 1 4 alpha D glucan glucanohydrolase
    • 1,4 alpha D glucan glucanohydrolase 2B
    • Alpha amylase
    • Alpha amylase 2B
    • AMY2
    • AMY2A
    • AMY2B
    • AMY3
    • Amylase alpha 2A
    • Amylase alpha 2A pancreatic
    • Amylase alpha 2B
    • Amylase alpha 2B pancreatic
    • Amylase pancreatic alpha 2A
    • Amylase pancreatic alpha 2B
    • Amylase, alpha 2A (pancreatic)
    • Amylase, alpha 2B (pancreatic)
    • Carcinoid alpha amylase
    • Found in the pancreas
    • Glycogenase
    • HXA
    • PA
    • Pancreatic alpha amylase
    • Pancreatic amylase 2A
    • Pancreatic amylase alpha 2A
    see all
  • Relevance
    Pancreatic amylase is a digestive enzyme secreted by the pancreas. It consists of a single polypeptide chain with a molecular weight of 54 kDa. Pancreatic amylase occurs in serum at a concentration of about 60µg/L, from a total amylase concentration in serum of about 120µg/L. Pancreatic amylase and salivary amylase are the products of separate genes and, although they share 98% amino acid sequence homology, they differ in molecular size, isoelectric point and antigenic properties. Measurement of amylase concentrations in serum is a diagnostic test for various pancreatic disorders (especially acute and relapsing pancreatitis).
  • Cellular localization
    Secreted protein; extracellular space.

Images

  • ab157887 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab157887 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab157887.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up