Description

  • Product name

    Recombinant Human Pancreatic Polypeptide protein
    See all Pancreatic Polypeptide proteins and peptides
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MAAARLCLSLLLLSTCVALLLQPLLGAQGAPLEPVYPGDNATPEQMAQYA ADLRRYINMLTRPRYGKRHKEDTLAFSEWGSPHAAVPRELSPLDL
    • Predicted molecular weight

      36 kDa including tags
    • Amino acids

      1 to 95

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114376 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Pancreatic polypeptide
    • Pancreatic polypeptide Y
    • Pancreatic prohormone
    • PNP
    • PP
    • PPY
    • prepro-PP (prepropancreatic polypeptide)
    see all
  • Relevance

    Pancreatic hormone is synthesized in pancreatic islets of Langerhans and acts as a regulator of pancreatic and gastrointestinal functions and may be important in the regulation of food intake. Plasma levels of this hormone have been shown to be reduced in conditions associated with increased food intake and elevated in anorexia nervosa. In addition, infusion of this hormone in obese rodents has shown to decrease weight gain.
  • Cellular localization

    Secreted

Images

  • 12.5% SDS-PAGE with ab114376 at 36.19kDa, stained with Coomassie Blue.

References

ab114376 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114376.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up