Overview

Description

  • Nature

    Recombinant
  • Source

    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRYGKRHKEDTLAFSEW GSPHAAVPRVDHHHHHH
    • Molecular weight

      8 kDa including tags
    • Amino acids

      30 to 88
    • Tags

      His tag C-Terminus
    • Additional sequence information

      This product is for the mature full length protein. The propeptide is not included. The signal peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab194031 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    HPLC

    SDS-PAGE

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 95 % SDS-PAGE.
    Purity is greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C.

    pH: 7.4
    Constituents: 0.87% Sodium chloride, 99% Phosphate Buffer

  • Reconstitution
    Reconstituted protein solution can be stored at 4-7 deg.C for 2-7 days. Aliquots of reconstituted samples are stable at < -20 deg.C for 3 months.

General Info

  • Alternative names

    • Pancreatic polypeptide
    • Pancreatic polypeptide Y
    • Pancreatic prohormone
    • PNP
    • PP
    • PPY
    • prepro-PP (prepropancreatic polypeptide)
    see all
  • Relevance

    Pancreatic hormone is synthesized in pancreatic islets of Langerhans and acts as a regulator of pancreatic and gastrointestinal functions and may be important in the regulation of food intake. Plasma levels of this hormone have been shown to be reduced in conditions associated with increased food intake and elevated in anorexia nervosa. In addition, infusion of this hormone in obese rodents has shown to decrease weight gain.
  • Cellular localization

    Secreted

References

ab194031 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab194031.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up