Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MKIKDAKKPSFPWFGMDIGGTLVKLSYFEPIDITAEEEQEEVESLKSIRK YLTSNVAYGSTGIRDVHLELKDLTLFGRRGNLHFIRFPTQDLPTFIQMGR DKNFSTLQTVLCATGGGAYKFEKDFRTIGNLHLHKLDELDCLVKGLLYID SVSFNGQAECYYFANASEPERCQKMPFNLDDPYPLLVVNIGSGVSILAVH SKDNYKRVTGTSLGGGTFLGLCSLLTGCESFEEALEMASKGDSTQADKLV RDIYGGDYERFGLPGWAVASSFGNMIYKEKRESVSKEDLARATLVTITNN IGSVARMCAVNEKINRVVFVGNFLRVNTLSMKLLAYALDYWSKGQLKALF LEHEGYFGAVGALLGLPNFS
    • Amino acids
      1 to 370
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164061 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DKFZp686O22247
    • FLJ12899
    • hPanK3
    • MGC16863
    • OTTHUMP00000160961
    • Pank3
    • PANK3_HUMAN
    • Pantothenate kinase 3
    • pantothenic acid kinase
    • Pantothenic acid kinase 3
    see all
  • Function
    Plays a role in the physiological regulation of the intracellular CoA concentration.
  • Tissue specificity
    Highly expressed in the liver.
  • Pathway
    Cofactor biosynthesis; coenzyme A biosynthesis; CoA from (R)-pantothenate: step 1/5.
  • Sequence similarities
    Belongs to the type II pantothenate kinase family.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • ab164061 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164061 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164061.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up