Overview

Description

  • Nature

    Recombinant
  • Source

    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      KELKFVTLVFRHGDRSPIDTFPTDPIKESSWPQGFGQLTQLGMEQHYELG EYIRKRYRKFLNESYKHEQVYIRSTDVDRTLMSAMTNLAALFPPEGVSIW NPILLWQPIPVHTVPLSEDQLLYLPFRNCPRFQELESETLKSEEFQKRLH PYKDFIATLGKLSGLHGQDLFGIWSKVYDPLYCESVHNFTLPSWATEDTM TKLRELSELSLLSLYGIHKQKEKSRLQGGVLVNEILNHMKRATQIPSYKK LIMYSAHDTTVSGLQMALDVYNGLLPPYASCHLTELYFEKGEYFVEMHYR NETQHEPYPLMLPGCSPSCPLERFAELVGPVIPQDWSTECMTTNSHQGTE DSTDVDHHHHHH
    • Molecular weight

      42 kDa including tags
    • Amino acids

      33 to 386
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab152091 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 95 % SDS-PAGE.
    Purity is greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. ab152091 was 0.2 µM filtered.
  • Form

    Liquid
  • Additional notes

     This product was previously labelled as Prostatic Acid Phosphatase

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 7.50
    Constituents: 0.32% Tris HCl, 0.88% Sodium chloride

General Info

  • Alternative names

    • 5'-NT
    • 5'-nucleotidase
    • Acid phosphatase prostate
    • ACP 3
    • ACP3
    • acpP
    • Ecto-5'-nucleotidase
    • PAP
    • PPAP_HUMAN
    • Prostatic acid phosphatase
    • Prostatic acid phosphotase
    • Thiamine monophosphatase
    • TMPase
    see all
  • Sequence similarities

    Belongs to the histidine acid phosphatase family.
  • Cellular localization

    Secreted and Lysosome membrane. Predominantly localized in the plasma membrane but also detected in intracellular vesicles.
  • Information by UniProt

References

ab152091 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152091.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up