Overview

  • Product name
    Recombinant Human PAPD4 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MFPNSILGRPPFTPNHQQHNNFFTLSPTVYSHQQLIDAQFNFQNADLSRA VSLQQLTYGNVSPIQTSASPLFRGRKRLSDEKNLPLDGKRQRFHSPHQEP TVVNQIVPLSGERRYSMPPLFHTHYVPDIVRCVPPFREIAFLEPREITLP EAKDKLSQQILELFETCQQQISDLKKKELCRTQLQREIQLLFPQSRLFLV GSSLNGFGTRSSDGDLCLVVKEEPCFFQVNQKTEARHILTLVHKHFCTRL SGYIERPQLIRAKVPIVKFRDKVSCVEFDLNVNNIVGIRNTFLLRTYAYL ENRVRPLVLVIKKWASHHQINDASRGTLSSYSLVLMVLHYLQTLPEPILP SLQKIYPESFSPAIQLHLVHQAPCNVPPYLSKNESNLGDLLLGFLKYYAT EFDWNSQMISVREAKAIPRPDGIEWRNKYICVEEPFDGTNTARAVHEKQK FDMIKDQFLKSWHRLKNKRDLNSILPVRAAVLKR
    • Amino acids
      1 to 484
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165792 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 8030446C20Rik
    • AI649009
    • FLJ38499
    • GLD 2
    • Gld2
    • GLD2_HUMAN
    • hGLD 2
    • hGLD-2
    • MGC93684
    • PAD 4
    • PAP associated domain containing 4
    • PAP-associated domain-containing protein 4
    • papd4
    • Poly(A) RNA polymerase GLD2
    • Terminal uridylyltransferase 2
    • TUTase 2
    see all
  • Function
    Cytoplasmic poly(A) RNA polymerase that adds successive AMP monomers to the 3'-end of specific RNAs, forming a poly(A) tail. In contrast to the canonical nuclear poly(A) RNA polymerase, it only adds poly(A) to selected cytoplasmic mRNAs. Does not play a role in replication-dependent histone mRNA degradation.
  • Tissue specificity
    Expressed in brain. Within brain, it is expressed in cerebellum, hippocampus and medulla.
  • Sequence similarities
    Belongs to the DNA polymerase type-B-like family. GLD2 subfamily.
    Contains 1 PAP-associated domain.
  • Cellular localization
    Cytoplasm. Nucleus.
  • Information by UniProt

Images

  • ab165792 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165792 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165792.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up