Description

  • Product name

    Recombinant Human Papillomavirus 16 (E7) protein (His tag)
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human papillomavirus
    • Sequence

      MHGDTPTLHEYMLDLQPETTDLYCYEQLNDSSEEEDEIDGPAGQAEPDRA HYNIVTFCCKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKP
    • Predicted molecular weight

      15 kDa including tags
    • Amino acids

      1 to 98
    • Tags

      His tag N-Terminus
  • Description

    Recombinant Human papillomavirus Human Papillomavirus 16 (E7) protein (His tag)

Specifications

Our Abpromise guarantee covers the use of ab237790 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry

    LC-MS/MS
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • E7
    • HPV16 E7
    • Protein E7
    • Transforming protein
  • Relevance

    E7 protein has both transforming and trans-activating activities. Disrupts the function of host retinoblastoma protein RB1/pRb, which is a key regulator of the cell cycle. Induces the disassembly of the E2F1 transcription factors from RB1, with subsequent transcriptional activation of E2F1-regulated S-phase genes. Inactivation of the ability of RB1 to arrest the cell cycle is critical for cellular transformation, uncontrolled cellular growth and proliferation induced by viral infection. Stimulation of progression from G1 to S phase allows the virus to efficiently use the cellular DNA replicating machinery to achieve viral genome replication. Interferes with histone deacetylation mediated by HDAC1 and HDAC2, leading to activation of transcription
  • Cellular localization

    Nuclear

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis with 5% enrichment gel and 15% separation gel of ab237790.

  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of ab237790 could indicate that this peptide derived from E.coli-expressed Human Papillomavirus 16 (E7).

  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of ab237790 could indicate that this peptide derived from E.coli-expressed Human Papillomavirus 16 (E7).

References

ab237790 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab237790.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up