Overview

  • Product name
    Recombinant Human PAPOLB protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MMPFPVTTQGPPQPAPPPNRYGVSSPISLAVPKETDCLLTQRLIETLRPF GVFEEEEELQRRILVLDKLNNLVKEWIREISESKSLPQSVIENVGGKIFT FGSYRLGVHTKGADIDALCVAPSHVDRSDFFTSFYAKLKLQEEVKDLRAV QEAFVPVIKLCFDGIEIDILFARLALQTIPEDLDLRDDSLLKNLDIRCIR SLNGCRVTDEILHLVPNIDNFRLTLRAIKLWAKCHNIYSNILGFLGGVSW AMLVARTCQLYPNAVASTLVRKFFLVFSEWEWPNPVLLKEPEERNLNLPV WDPRVNPSDRYHLMPIITPAYPQQNSTYNVSISTRMVMIEEFKQGLAITH EILLSKAEWSKLFEAPSFFQKYKHYIVLLASASTEKQHLEWVGLVESKIR ILVGSLEKNEFITLAHVNPQSFPAPKENPDMEEFRTMWVIGLGLKKPDNS EILSIDLTYDIQSFTDTVYRQAVNSKMFEMGMKITAVHLRRKELHQLLPH HVLQDKKAHSTEGRRLTDLNDSSFDLSAGCENSMSVPSSTSTMKTGPLIS SSQGRNSPALAVMTASVANIQATEFSLQQVNTNESSGVALNESIPHAVSQ PAISPSPKAMVARVVSSTCLISHPDLQETQQQTYLIL
    • Amino acids
      1 to 637
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163420 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • PAP-beta
    • PAPT
    • poly(A) polymerase beta
    • poly(A) polymerase beta (testis specific)
    • polynucleotide adenylyltransferase beta
    • TPAP
    see all
  • Relevance
    The function of this protein remains unknown. This gene is a member of the myotubularin family and encodes a putative tyrosine phosphatase. Mutations in this gene are a cause of Charcot-Marie-Tooth disease type 4B, an autosomal recessive demyelinating neuropathy. Multiple alternatively spliced transcript variants have been found for this gene, but the protein products of some of these variants are likely not viable, as they are nonsense-mediated mRNA decay (NMD) candidates.
  • Cellular localization
    Nuclear

Images

  • ab163420 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163420 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163420.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up