Overview

  • Product name

    Recombinant Human PAPSS1 protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MQRATNVTYQAHHVSRNKRGQVVGTRGGFRGCTVWLTGLSGAGKTTVSMA LEEYLVCHGIPCYTLDGDNIRQGLNKNLGFSPEDREENVRRIAEVAKLFA DAGLVCITSFISPYTQDRNNARQIHEGASLPFFEVFVDAPLHVCEQRDVK GLYKKARAGEIKGFTGIDSEYEKPEAPELVLKTDSCDVNDCVQQVVELLQ ERDIVPVDASYEVKELYVPENKLHLAKTDAETLPALKINKVDMQWVQVLA EGWATPLNGFMREREYLQCLHFDCLLDGGVINLSVPIVLTATHEDKERLD GCTAFALMYEGRRVAILRNPEFFEHRKEERCARQWGTTCKNHPYIKMVME QGDWLIGGDLQVLDRVYWNDGLDQYRLTPTELKQKFKDMNADAVFAFQLR NPVHNGHALLMQDTHKQLLERGYRRPVLLLHPLGGWTKDDDVPLMWRMKQ HAAVLEEGVLNPETTVVAIFPSPMMYAGPTEVQWHCRARMVAGANFYIVG RDPAGMPHPETGKDLYEPSHGAKVLTMAPGLITLEIVPFRVAAYNKKKKR MDYYDSEHHEDFEFISGTRMRKLAREGQKPPEGFMAPKAWTVLTEYYKSL EKA
    • Molecular weight

      95 kDa including tags
    • Amino acids

      22 to 624

Specifications

Our Abpromise guarantee covers the use of ab133001 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 3 prime phosphoadenosine 5 prime phosphosulfate synthase 1
    • 3' phosphoadenosine 5' phosphosulfate synthase 1
    • 3''-phosphoadenosine-5''-phosphosulfate synthase
    • Adenosine-5''-phosphosulfate 3''-phosphotransferase
    • Adenylyl-sulfate kinase
    • Adenylylsulfate 3''-phosphotransferase
    • APS kinase
    • ATP-sulfurylase
    • ATPSK 1
    • ATPSK1
    • ATPSK2
    • Bifunctional 3' phosphoadenosine 5' phosphosulfate synthetase 1
    • PAPS synthase 1
    • PAPS synthetase 1
    • PAPS1_HUMAN
    • PAPSS
    • PAPSS 1
    • PAPSS1
    • SAT
    • SK 1
    • SK1
    • SK2
    • Sulfate adenylate transferase
    • Sulfurylase kinase 1
    see all
  • Function

    Bifunctional enzyme with both ATP sulfurylase and APS kinase activity, which mediates two steps in the sulfate activation pathway. The first step is the transfer of a sulfate group to ATP to yield adenosine 5'-phosphosulfate (APS), and the second step is the transfer of a phosphate group from ATP to APS yielding 3'-phosphoadenylylsulfate (PAPS: activated sulfate donor used by sulfotransferase). In mammals, PAPS is the sole source of sulfate; APS appears to be only an intermediate in the sulfate-activation pathway. Also involved in the biosynthesis of sulfated L-selectin ligands in endothelial cells.
  • Tissue specificity

    Expressed in testis, pancreas, kidney, thymus, prostate, ovary, small intestine, colon, leukocytes and liver. Also expressed in high endothelial venules (HEV) cells and in cartilage.
  • Pathway

    Sulfur metabolism; sulfate assimilation.
  • Sequence similarities

    In the N-terminal section; belongs to the APS kinase family.
    In the C-terminal section; belongs to the sulfate adenylyltransferase family.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab133001 stained with Coomassie Blue.

References

ab133001 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab133001.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up