Description

  • Product name

    Recombinant Human PAQR10 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MFAPRLLDFQKTKYARFMNHRVPAHKRYQPTEYEHAANCATHAFWIIPSI LGSSNLYFLSDDDWETISAWIYGLGLCGLFVVSTVFHTISWKKSHLRMVE HCIHMFDRMVIYFFIAASYAPWLNLRELGPWASHMRWLVWIMASVGTIYV FFFHERYKLVELLCYVVMGFFPALVILSMPNTEGIWELVTGGVFYCLGMV FFKSDGRIPFAHAIWHLFVAFGAGTHYYAIWRYLYLPSTLQTKVSK
    • Amino acids

      1 to 246
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165983 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as MMD2

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • FLJ37205
    • MMD 2
    • Monocyte to macrophage differentiation associated 2
    • Monocyte to macrophage differentiation associated protein 2
    • Monocyte to macrophage differentiation factor 2
    • PAQR10
    • Progestin and adipoQ receptor family member 10
    • Progestin and adipoQ receptor family member X
    see all
  • Relevance

    MMD2 is a homologue of MMD and both proteins are members of the so far uncharacterized Hemolysin-III (Hly-III) family, and are atypical members of the PAQR family. PAQR10/MMD2, has recently (Góñez et al.Nov/Dec 2008) been found to be expressed in mouse pancreatic islet beta cells, and may have a role in the endocrine pancreas development and hyperplasia in pregnancy.
  • Cellular localization

    Golgi apparatus membrane; Multi-pass membrane protein

Images

  • ab165983 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165983 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165983.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up