Description

  • Product name

    Recombinant Human PAQR8 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MTTAILERLSTLSVSGQRLRRLPKILEDGLPKMPCTVPETDVPQLFREPY IRTGYRPTGHEWRYYFFSLFQKHNEVVNVWTHLLAALAVLLRFWAFAEAE ALPWASTHSLPLLLFILSSITYLTCSLLAHLLQSKSELSHYTFYFVDYVG VSVYQYGSALAHFFYSSDQAWYDRFWLFFLPAAAFCGWLSCAGCCYAKYC YRRPYPVMRKICQVVPAGLAFILDISPVAHRVALCHLAGCQEQAAWYHTL QILFFLVSAYFFSCPVPEKYFPGSCDIVGHGHQIFHAFLSICTLSQLEAI LLDYQGRQEIFLQRHGPLSVHMACLSFFFLAACSAATAALLRHKVKARLT KKDS
    • Amino acids

      1 to 354
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164739 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as Progestin Receptor Beta

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • C6orf33
    • LMPB1
    • Lysosomal membrane protein in brain 1
    • Membrane progestin receptor beta
    • mPR beta
    • MPRB
    • PAQR8
    • Progestin and adipoQ receptor family member 8
    • Progestin and adipoQ receptor family member VIII
    see all
  • Relevance

    MPRb (Membrane progestin receptor beta) is a steroid membrane receptor and binds progesterone. MPRb may be involved in oocyte maturation. MPRb is an integral membrane protein and is expressed in brain and testis. It belongs to the ADIPOR family.
  • Cellular localization

    Cell Membrane. Multi-pass membrane protein. Note: Colocalizes with a lysosomal protein cathepsin D.

Images

  • ab164739 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164739 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164739.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up