Overview

  • Product name

    Recombinant Human PAR2 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MRSPSAAWLLGAAILLAASLSCSGTIQGTNRSSKGRSLIGKVDGTSHVTG KGVTVETVFSVDEFSASVLTGKLTTVFLPIVYTIVFVVGLPSNGMALWVF LFRTKKKHPAVIYMANLALADLLSVIWFPLKIAYHIHGNNWIYGEALCNV LIGFFYGNMYCSILFMTCLSVQRYWVIVNPMGHSRKKANIAIGISLAIWL LILLVTIPLYVVKQTIFIPALNITTCHDVLPEQLLVGDMFNYFLSLAIGV FLFPAFLTASAYVLMIRMLRSSAMDENSEKKRKRAIKLIVTVLAMYLICF TPSNLLLVVHYFLIKSQGQSHVYALYIVALCLSTLNSCIDPFVYYFVSHD FRDHAKNALLCRSVRTVKQMQVSLTSKKHSRESSSYSSSSTTVKTSY
    • Molecular weight

      69 kDa including tags
    • Amino acids

      1 to 397

Associated products

Specifications

Our Abpromise guarantee covers the use of ab152372 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Coagulation factor II receptor like 1
    • Coagulation factor II receptor-like 1
    • Coagulation factor II thrombin receptor like 1
    • F2RL1
    • G protein coupled receptor 11
    • G-protein coupled receptor 11
    • GPR11
    • PAR 2
    • PAR-2
    • PAR2_HUMAN
    • Protease activated receptor 2
    • Proteinase activated receptor 2
    • Proteinase-activated receptor 2
    • Thrombin receptor like 1
    • Thrombin receptor-like 1
    see all
  • Function

    Receptor for trypsin and trypsin-like enzymes coupled to G proteins that stimulate phosphoinositide hydrolysis. May have a role in the regulation of vascular tone.
  • Tissue specificity

    Widely expressed in tissues with especially high levels in pancreas, liver, kidney, small intestine, and colon. Moderate expression is detected in many organs, but none in brain or skeletal muscle.
  • Sequence similarities

    Belongs to the G-protein coupled receptor 1 family.
  • Post-translational
    modifications

    A proteolytic cleavage generates a new N-terminus that functions as a tethered ligand.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152372 stained with Coomassie Blue.

References

ab152372 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152372.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up