Overview

  • Product name

    Recombinant Human PAR6 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MARPQRTPARSPDSIVEVKSKFDAEFRRFALPRASVSGFQEFSRLLRAVH QIPGLDVLLGYTDAHGDLLPLTNDDSLHRALASGPPPLRLLVQKREADSS GLAFASNSLQRRKKGLLLRPVAPLRTRPPLLISLPQDFRQVSSVIDVDLL PETHRRVRLHKHGSDRPLGFYIRDGMSVRVAPQGLERVPGIFISRLVRGG LAESTGLLAVSDEILEVNGIEVAGKTLDQVTDMMVANSHNLIVTVKPANQ RNNVVRGASGRLTGPPSAGPGPAEPDSDDDSSDLVIENRQPPSSNGLSQG PPCWDLHPGCRHPGTRSSLPSLDDQEQASSGWGSRIRGDGSGFSL
    • Molecular weight

      64 kDa including tags
    • Amino acids

      1 to 345

Specifications

Our Abpromise guarantee covers the use of ab132012 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 0710008C04Rik
    • 2610010A15Rik
    • Par 6 partitioning defective 6 C elegans homolog alpha
    • Par 6 partitioning defective 6 homolog alpha
    • Par 6 partitioning defective 6 homolog alpha C elegans
    • PAR 6A
    • PAR-6
    • PAR-6 alpha
    • par-6 family cell polarity regulator alpha
    • PAR-6A
    • PAR6
    • PAR6A_HUMAN
    • PAR6alpha
    • PAR6C
    • Pard6a
    • Partitioning defective 6 homolog alpha
    • partitioning-defective protein 6
    • partitioning-defective protein 6, C. elegans, homolog of, alpha
    • Tax interacting protein 40
    • Tax interaction protein 40
    • TAX40
    • TIP 40
    • TIP-40
    • TIP40
    see all
  • Function

    Adapter protein involved in asymmetrical cell division and cell polarization processes. Probably involved in the formation of epithelial tight junctions. Association with PARD3 may prevent the interaction of PARD3 with F11R/JAM1, thereby preventing tight junction assembly. The PARD6-PARD3 complex links GTP-bound Rho small GTPases to atypical protein kinase C proteins.
  • Tissue specificity

    Expressed in pancreas, skeletal muscle, brain and heart. Weakly expressed in kidney and placenta.
  • Sequence similarities

    Belongs to the PAR6 family.
    Contains 1 OPR domain.
    Contains 1 PDZ (DHR) domain.
    Contains 1 pseudo-CRIB domain.
  • Domain

    The pseudo-CRIB domain together with the PDZ domain is required for the interaction with Rho small GTPases.
    The OPR domain mediates interactions with MAP2K5.
    The PDZ domain mediates the interaction with CRB3.
  • Cellular localization

    Cytoplasm. Cell membrane. Cell projection > ruffle. Cell junction > tight junction. Colocalizes with GTP-bound CDC42 or RAC1 at membrane ruffles and with PARD3 and PRKCI at epithelial tight junctions.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab132012 at approximately 63.7 kDa.

References

ab132012 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132012.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up