Description

  • Product name

    Recombinant human Parathyroid Hormone protein
    See all Parathyroid Hormone proteins and peptides
  • Biological activity

    Fully biologically active when compared to standard.

    The ED50 as determined by its ability to induce cAMP accumulation in murine MC3T3E1 cells is less than 50 ng/ml, corresponding to a specific activity of > 2.0 × 104 IU/mg.

  • Purity

    > 97 % SDS-PAGE.
    > 97 % by HPLC analysis.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQR PRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQ
    • Predicted molecular weight

      9 kDa
    • Amino acids

      32 to 115
    • Additional sequence information

      Single non-glycosylated polypeptide chain containing 84 amino acids. 15N Stable Isotope labeled. This product is for the mature full length protein. The signal peptide and propeptide are not included.

Associated products

Specifications

Our Abpromise guarantee covers the use of ab201365 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    HPLC

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C long term. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituent: 100% PBS

    Lyophilized from a 0.2µm filtered solution.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Briefly centrifuge the vial prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <-20°C. Further dilutions should be made in appropriate buffered solutions.

General Info

  • Alternative names

    • hPTH
    • Parathormone
    • Parathyrin
    • Parathyroid hormone
    • Parathyroid hormone 1
    • Prepro PTH
    • Preproparathyroid hormone
    • PTH
    • PTH1
    • PTH1 receptor
    • PTH1R
    • PTHR
    • PTHR1
    • PTHY_HUMAN
    see all
  • Function

    PTH elevates calcium level by dissolving the salts in bone and preventing their renal excretion. Stimulates [1-14C]-2-deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblastic cells.
  • Involvement in disease

    Defects in PTH are a cause of familial isolated hypoparathyroidism (FIH) [MIM:146200]; also called autosomal dominant hypoparathyroidism or autosomal dominant hypocalcemia. FIH is characterized by hypocalcemia and hyperphosphatemia due to inadequate secretion of parathyroid hormone. Symptoms are seizures, tetany and cramps. FIH exist both as autosomal dominant and recessive forms of hypoparathyroidism.
  • Sequence similarities

    Belongs to the parathyroid hormone family.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab201365 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab201365.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up