Overview

  • Product name

    Recombinant Human PARD6B protein (denatured)
  • Protein length

    Full length protein
  • Description

    Recombinant Human PARD6B protein

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSMNRSHRHGAGSGCLGTMEVKSKFGAEF RRFSLERSKPGKFEEFYGLLQHVHKIPNVDVLVGYADIHGDLLPINNDDN YHKAVSTANPLLRIFIQKKEEADYSAFGTDTLIKKKNVLTNVLRPDNHRK KPHIVISMPQDFRPVSSIIDVDILPETHRRVRLYKYGTEKPLGFYIRDGS SVRVTPHGLEKVPGIFISRLVPGGLAQSTGLLAVNDEVLEVNGIEVSGKS LDQVTDMMIANSRNLIITVRPANQRNNVVRNSRTSGSSGQSTDNSLLGYP QQIEPSFEPEDEDSEEDDIIIEDNGVPQQIPKAVPNTESLESLTQIELSF ESGQNGFIPSNEVSLAAIASSSNTEFETHAPDQKLLEEDGTIITL
    • Molecular weight

      44 kDa including tags
    • Amino acids

      1 to 372
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab139223 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 85 % SDS-PAGE.

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 12.01% Urea, 0.32% Tris HCl, 20% Glycerol, 1.17% Sodium chloride

General Info

  • Alternative names

    • OTTHUMP00000031269
    • PAR 6 beta
    • Par 6 partitioning defective 6 homolog beta (C. elegans)
    • PAR6B
    • PARD6 beta
    • PARD6B
    • partitioning defective 6 homolog beta
    • partitioning-defective protein 6, C. elegans, homolog of, beta
    see all
  • Relevance

    This gene is a member of the PAR6 family and encodes a protein with a PSD95/Discs-large/ZO1 (PDZ) domain, an OPR domain and a semi-Cdc42/Rac interactive binding (CRIB) domain. This cytoplasmic protein is involved in asymmetrical cell division and cell polarization processes as a member of a multi protein complex.
  • Cellular localization

    Cytoplasm. Cell membrane. Cell junction, tight junction.

Images

  • 15% SDS-PAGE analysis of ab139223 (3µg).

References

ab139223 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab139223.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up