Overview

  • Product name

    Recombinant Human PARIS protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      AEAVAAPISPWTMAATIQAMERKIESQAARLLSLEGRTGMAEKKLADCEK TAVEFGNQLEGKWAVLGTLLQEYGLLQRRLENVENLLRNRNFWILRLPPG SKGESPKEWGKLEDWQKELYKHVMRGNYETLVSLDYAISKPEVLSQIEQG KEPCNWRRPGPKIPDVPVDPSPGSGPPVPAPDLLMQIKQEGELQLQEQQA LGVEAWAAGQPDIGEEPWGLSQLDSGAGDISTDATSGVHSNFSTTIPPTS WQTDLPPHHPSSACSDGTLKLNTAASTEDVKIVIKTEVQEEEVVATPVHP TDLEAHGTLFGPGQATRFFPSPAQEGAWESQGSSFPSQDPVLGLREPARP ERDMGELSPAVAQEETPPGDWLFGGVRWGWNFRCKPPVGLNPRTGPEGLP YSSPDNGEAILDPSQAPRPFNEPCKYPGRTKGFGHKPGLKKHPAAPPGGR PFTCATCGKSFQLQVSLSAHQRSCGAPDGSGPGTGGGGSGSGGGGGGSGG GSARDGSALRCGECGRCFTRPAHLIRHRMLHTGERPFPCTECEKRFTERS KLIDHYRTHTGVRPFTCTVCGKSFIRKDHLRKHQRNHAAGAKTPARGQPL PTPPAPPDPFKSPASKGPLASTDLVTDWTCGLSVLGPTDGGDM
    • Amino acids

      2 to 644
    • Tags

      T7 tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab134852 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Purity

    > 90 % SDS-PAGE.

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituent: 0.32% Tris HCl
    Note: Buffer contains NaCl, KCl, EDTA, Arginine, DTT and Glycerol.

General Info

  • Alternative names

    • PARIS
    • Parkin-interacting substrate
    • Zinc finger protein 746
    • ZN746_HUMAN
    • ZNF746
    see all
  • Function

    Transcription repressor that specifically binds to the 5'-TATTTT[T/G]-3' consensus sequence on promoters and repress transcription of PGC-1-alpha (PPARGC1A), thereby playing a role in regulation of neuron death.
  • Sequence similarities

    Belongs to the krueppel C2H2-type zinc-finger protein family.
    Contains 4 C2H2-type zinc fingers.
    Contains 1 KRAB domain.
  • Post-translational
    modifications

    Ubiquitinated by PARK2. 'Lys-48'-linked polyubiquitination by PARK2 leads to degradation by the proteasome and may play a key role in regulation of neuron death.
  • Cellular localization

    Cytoplasm. Nucleus. Mainly localizes to the cytoplasm; probably translocates to the nucleus to repress selected genes.
  • Information by UniProt

References

ab134852 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab134852.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up