Recombinant Human PARP1 protein (ab157069)
- Datasheet
- References
- Protocols
Overview
-
Product nameRecombinant Human PARP1 protein
See all PARP1 proteins and peptides -
Protein lengthProtein fragment
Description
-
NatureRecombinant
-
SourceEscherichia coli
-
Amino Acid Sequence
-
Accession
-
SpeciesHuman
-
SequenceSADKPLSNMKILTLGKLSRNKDEVKAMIEKLGGKLTGTANKASLCISTKK EVEKMNKKMEEVKEANIRVVSEDFLQDVSASTKSLQELFLAHILSPWGAE VKAEPVEVVAPRGKSGAALSKKSKGQVKEEGINKSEKRMK
-
Molecular weight15 kDa
-
Amino acids385 to 524
-
Additional sequence informationFused to a His-tag.
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab157069 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
-
Purity>= 99 % SDS-PAGE.
ab157069 was affinity purified on Ni-beads. -
FormLiquid
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.
pH: 8.00
Preservative: 0.41% Imidazole
Constituents: 0.009% PMSF, 0.79% Tris HCl, 10% Glycerol, 1.17% Sodium chloride
General Info
-
Alternative names
- ADP ribosyltransferase
- ADP ribosyltransferase (NAD+; poly (ADP ribose) polymerase)
- ADP ribosyltransferase diphtheria toxin like 1
see all -
FunctionInvolved in the base excision repair (BER) pathway, by catalyzing the poly(ADP-ribosyl)ation of a limited number of acceptor proteins involved in chromatin architecture and in DNA metabolism. This modification follows DNA damages and appears as an obligatory step in a detection/signaling pathway leading to the reparation of DNA strand breaks. Mediates the poly(ADP-ribosyl)ation of APLF and CHFR. Positively regulates the transcription of MTUS1 and negatively regulates the transcription of MTUS2/TIP150.
-
Sequence similaritiesContains 1 BRCT domain.
Contains 1 PARP alpha-helical domain.
Contains 1 PARP catalytic domain.
Contains 2 PARP-type zinc fingers. -
Post-translational
modificationsPhosphorylated by PRKDC. Phosphorylated upon DNA damage, probably by ATM or ATR.
Poly-ADP-ribosylated by PARP2. Poly-ADP-ribosylation mediates the recruitment of CHD1L to DNA damage sites.
S-nitrosylated, leading to inhibit transcription regulation activity. -
Cellular localizationNucleus.
- Information by UniProt
Images
-
SDS-PAGE - Recombinant Human PARP1 protein (ab157069)Total cell extract from E. coli BL21 cells before (lane 1) and after (lane 2) induction of the expression of Human PARP1 ab157069 with 0.5mM IPTG for 2 hours. Lanes 3-5: Purified Human PARP1 (BRCT Domain).
References
ab157069 has not yet been referenced specifically in any publications.
