Description

  • Product name

    Recombinant Human PARP1 protein (Automodified)
    See all PARP1 proteins and peptides
  • Expression system

    Baculovirus
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MAESSDKLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPH WYHFSCFWKVGHSIRHPDVEVDGFSELRWDDQQKVKKTAEAGGVTGKGQD GIGSKAEKTLGDFAAEYAKSNRSTCKGCMEKIEKGQVRLSKKMVDPEKPQ LGMIDRWYHPGCFVKNREELGFRPEYSASQLKGFSLLATEDKEALKKQLP GVKSEGKRKGDEVDGVDEVAKKKSKKEKDKDSKLEKALKAQNDLIWNIKD ELKKVCSTNDLKELLIFNKQQVPSGESAILDRVADGMVFGALLPCEECSG QLVFKSDAYYCTGDVTAWTKCMVKTQTPNRKEWVTPKEFREISYLKKLKV KKQDRIFPPETSASVAATPPPSTASAPAAVNSSASADKPLSNMKILTLGK LSRNKDEVKAMIEKLGGKLTGTANKASLCISTKKEVEKMNKKMEEVKEAN IRVVSEDFLQDVSASTKSLQELFLAHILSPWGAEVKAEPVEVVAPRGKSG AALSKKSKGQVKEEGINKSEKRMKLTLKGGAAVDPDSGLEHSAHVLEKGG KVFSATLGLVDIVKGTNSYYKLQLLEDDKENRYWIFRSWGRVGTVIGSNK LEQMPSKEDAIEHFMKLYEEKTGNAWHSKNFTKYPKKFYPLEIDYGQDEE AVKKLTVNPGTKSKLPKPVQDLIKMIFDVESMKKAMVEYEIDLQKMPLGK LSKRQIQAAYSILSEVQQAVSQGSSDSQILDLSNRFYTLIPHDFGMKKPP LLNNADSVQAKVEMLDNLLDIEVAYSLLRGGSDDSSKDPIDVNYEKLKTD IKVVDRDSEEAEIIRKYVKNTHATTHNAYDLEVIDIFKIEREGECQRYKP FKQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM VSKSANYCHTSQGDPIGLILLGEVALGNMYELKHASHISKLPKGKHSVKG LGKTTPDPSANISLDGVDVPLGTGISSGVNDTSLLYNEYIVYDIAQVNLK YLLKLKFNFKTSLW
    • Amino acids

      1 to 1014

Specifications

Our Abpromise guarantee covers the use of ab75605 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form

    Lyophilised
  • Additional notes

    NAD+ and cofactors have been added to the baculovirus expression system to allow PARP automodification by poly(ADP-ribose).

    Reconstituted PARP1 will retain residual polyADP-ribosylation enzymatic activity.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. After reconstitution store at -20ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.095% Magnesium chloride, 0.0154% DTT, 0.605% Tris, 0.58% Sodium chloride, 0.0663% NAD, 0.001% Activated DNA

  • Reconstitution
    To reconstitute,add 100µl distilled water and leave for 5 min. Vortex gently for 1 min, avoiding air bubbles. Spin briefly.

General Info

  • Alternative names

    • ADP ribosyltransferase
    • ADP ribosyltransferase (NAD+; poly (ADP ribose) polymerase)
    • ADP ribosyltransferase diphtheria toxin like 1
    • ADP ribosyltransferase NAD(+)
    • ADPRT
    • ADPRT 1
    • ADPRT1
    • ARTD1
    • msPARP
    • NAD(+) ADP ribosyltransferase 1
    • NAD(+) ADP-ribosyltransferase 1
    • pADPRT 1
    • pADPRT-1
    • pADPRT1
    • PARP
    • PARP 1
    • PARP-1
    • PARP1
    • PARP1_HUMAN
    • Poly (ADP ribose) polymerase 1
    • poly (ADP ribose) polymerase family, member 1
    • Poly (ADP-ribose) polymerase 1
    • Poly [ADP-ribose] polymerase 1
    • Poly(ADP ribose) polymerase
    • poly(ADP ribose) synthetase
    • poly(ADP ribosyl)transferase
    • Poly(ADP-ribosyl)transferase
    • Poly[ADP ribose] synthetase 1
    • Poly[ADP-ribose] synthase 1
    • PPOL
    • sPARP 1
    • sPARP1
    see all
  • Function

    Involved in the base excision repair (BER) pathway, by catalyzing the poly(ADP-ribosyl)ation of a limited number of acceptor proteins involved in chromatin architecture and in DNA metabolism. This modification follows DNA damages and appears as an obligatory step in a detection/signaling pathway leading to the reparation of DNA strand breaks. Mediates the poly(ADP-ribosyl)ation of APLF and CHFR. Positively regulates the transcription of MTUS1 and negatively regulates the transcription of MTUS2/TIP150.
  • Sequence similarities

    Contains 1 BRCT domain.
    Contains 1 PARP alpha-helical domain.
    Contains 1 PARP catalytic domain.
    Contains 2 PARP-type zinc fingers.
  • Post-translational
    modifications

    Phosphorylated by PRKDC. Phosphorylated upon DNA damage, probably by ATM or ATR.
    Poly-ADP-ribosylated by PARP2. Poly-ADP-ribosylation mediates the recruitment of CHD1L to DNA damage sites.
    S-nitrosylated, leading to inhibit transcription regulation activity.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • Lane A: unmodified PARP1 LANE B: automodified PARP1 Lane B shows a smear of staining above MW 113kDa indicating polyADP-ribosylated PARP1 modified to various extents. A significant amount of automodified PARP1 did not enter the gel (top arrow). This image shows that most of the PARP1 will be at the top of the gel with a smear running up from 113kDa indicating PARP1 is automodified to various extents. There is little or no native PARP1 at 113kDa.

  • All lanes : Anti-PARP1 antibody at 5 µg/ml

    Lane 1 : PARP1 - unmodified
    Lane 2 : Recombinant Human PARP1 protein (Automodified) (ab75605)

    Lysates/proteins at 0.1 µg per lane.

    Predicted band size: 113 kDa
    Observed band size: >250 kDa
    why is the actual band size different from the predicted?



    No staining is visible in Lane 1 (unmodified PARP1). Lane 2 shows a smear above M.Wt 113 kda indication poly ribosylated PARP1 modified to various extents.

References

ab75605 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab75605.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up