Description

  • Product name

    Recombinant human PARP14 protein
  • Biological activity

    One unit of PARP incorporates 100 pmoles of poly(ADP) in 1 minute from NAD into the acid-insoluble form. Enzyme reaction is conducted using a PARP14 Assay Kit at room temperature for 1 hour.

  • Expression system

    Baculovirus infected Sf9 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MHHHHHHGGGSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKW RNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAE ISMLEGAVLDIRYGVSRIAYSKDFETLVDFLSKLPEMLKMFKDRLCHKTY LNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKY LKSSKYIAWPLQGWQATFGGGDHPPKSDPENLYFQGGGEFKEYQELNELQ KKLNNISLDHKRPLIKVLGISRDVMQARDEIEAMIKRVRLAKEQESRADC ISEFIEWQYNDNNTSHCFNKMTNLKLEDARREKKKTVDVKINHRHYTVNL NTYTATDTKGHSLSVQRLTKSKVDIPAHWSDKQQNFCVVELLPSDPEYNT VASKFNQTCSHFRIEKIERIQNPDLWNSYQAKKKTMDAKNGQTMNEKQLF HGTDAGSVPHVNRNGFNRSYAGKNAVAYGKGTYFAVNANYSANDTYSRPD ANGRKHVYVRVLTGIYTHGNHSLIVPPSKNPQNPTDLYDTVTDNVHHPSL FVAFYDYQAYPEYLITFRK
    • Predicted molecular weight

      67 kDa including tags
    • Amino acids

      1470 to 1801
    • Tags

      His tag N-Terminus , GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab198628 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Preservative: 1.28% Imidazole
    Constituents: 0.63% Tris HCl, 0.64% Sodium chloride, 0.017% Potassium chloride, 0.04% Tween, 20% Glycerol

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • ADP-ribosyltransferase diphtheria toxin-like 8
    • ARTD8
    • B aggressive lymphoma protein 2
    • BAL2
    • Collaborator of STAT6
    • KIAA1268
    • PAR14_HUMAN
    • PARP 14
    • PARP-14
    • PARP14
    • pART8
    • Poly (ADP ribose) polymerase family member 14
    • Poly [ADP-ribose] polymerase 14
    see all
  • Function

    Enhances STAT6-dependent transcription (By similarity). Has ADP-ribosyltransferase activity.
  • Sequence similarities

    Contains 3 Macro domains.
    Contains 1 PARP catalytic domain.
    Contains 1 WWE domain.
  • Cellular localization

    Nucleus. Cytoplasm. In steady state cells the protein is mostly nuclear. A minor proportion is detected in the cytoplasm.
  • Information by UniProt

Images

  • Specific activity of ab198628.

  • 4-20 % SDS-PAGE analysis of ab198628 with Coomassie staining.
    Lane 1: 1 µg ab198628
    Lane 2: Protein marker

References

ab198628 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab198628.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up