Description

  • Product name

    Recombinant human PARP15 protein
  • Biological activity

    One unit of PARP incorporates 100 pmoles of poly(ADP) in 1 minute from NAD into the acid-insoluble form.

    Enzyme reaction is conducted using a PARP15 Assay Kit at room temperature for 30 minutes.

  • Purity

    >= 55 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGL EFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVL DIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTH PDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIA WPLQGWQATFGGGDHPPKSDLEVLFQGPLGSIFYDSMKKRDLSASLNFQS TFSMTTCNLPEHWTDMNHQLFCMVQLEPGQSEYNTIKDKFTRTCSSYAIE KIERIQNAFLWQSYQVKKRQMDIKNDHKNNERLLFHGTDADSVPYVNQHG FNRSCAGKNAVSYGKGTYFAVDASYSAKDTYSKPDSNGRKHMYVVRVLTG VFTKGRAGLVTPPPKNPHNPTDLFDSVTNNTRSPKLFVVFFDNQAYPEYL ITFTA
    • Predicted molecular weight

      53 kDa including tags
    • Amino acids

      221 to 444
    • Tags

      GST tag N-Terminus
    • Additional sequence information

      GenBank Accession No. NM_152615

Associated products

Specifications

Our Abpromise guarantee covers the use of ab198468 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Liquid
  • Additional notes

    ab198468 is useful for the study of enzyme kinetics, screening inhibitors, and selectivity profiling.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.0
    Constituents: 0.63% Tris HCl, 20% Glycerol, 0.64% Sodium chloride, 0.02% Potassium chloride, 0.04% Tween, 0.05% DTT

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • ADP-ribosyltransferase diphtheria toxin-like 7
    • ARTD7
    • B aggressive lymphoma 3
    • B aggressive lymphoma protein 3
    • B-aggressive lymphoma protein 3
    • BAL3
    • FLJ40196
    • FLJ40597
    • MGC126750
    • MGC126752
    • PAR15_HUMAN
    • PARP 15
    • PARP-15
    • PARP15
    • Poly (ADP ribose) polymerase family member 15
    • Poly [ADP ribose] polymerase 15
    • Poly [ADP-ribose] polymerase 15
    see all
  • Function

    Transcriptional repressor. Has ADP-ribosyltransferase activity.
  • Sequence similarities

    Contains 2 Macro domains.
    Contains 1 PARP catalytic domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • 10% SDS PAGE of 2 μg ab198468 stained with Coomassie.

  • Specific activity analysis of ab198468.

References

ab198468 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab198468.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up