Recombinant Human PARP16 protein (ab162911)

Overview

  • Product name
    Recombinant Human PARP16 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MQPSGWAAAREAAGRDMLAADLRCSLFASALQSYKRDSVLRPFPASYARG DCKDFEALLADASKLPNLKELLQSSGDNHKRAWDLVSWILSSKVLTIHSA GKAEFEKIQKLTGAPHTPVPAPDFLFEIEYFDPANAKFYETKGERDLIYA FHGSRLENFHSIIHNGLHCHLNKTSLFGEGTYLTSDLSLALIYSPHGHGW QHSLLGPILSCVAVCEVIDHPDVKCQTKKKDSKEIDRRRARIKHSEGGDI PPKYFVVTNNQLLRVKYLLVYSQKPPKSRASSQLSWFSSHWFTVMISLYL LLLLIVSVINSSAFQHFWNRAKR
    • Amino acids
      1 to 323
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162911 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ADP ribosyltransferase diphtheria toxin like 15
    • ADP-ribosyltransferase diphtheria toxin-like 15
    • ARTD 15
    • ARTD15
    • C15orf30
    • Chromosome 15 open reading frame 30
    • EC 2.4.2.30
    • FLJ20509
    • FLJ25281
    • mono [ADP-ribose] polymerase PARP16
    • mono ADP ribose polymerase PARP16
    • PAR16_HUMAN
    • PARP 16
    • PARP-16
    • Parp16
    • pART 15
    • pART15
    • Poly (ADP ribose) polymerase family member 16
    • Poly [ADP ribose] polymerase 16
    • Poly [ADP-ribose] polymerase 16
    • poly ADP ribose polymerase 16
    see all
  • Sequence similarities
    Contains 1 PARP catalytic domain.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab162911 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162911 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162911.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up