Description

  • Product name

    Recombinant human PARP2 protein
    See all PARP2 proteins and peptides
  • Biological activity

    Unit Definition: One unit of PARP incorporates 100 pmoles of poly(ADP) in 1 minute from NAD into the acid-insoluble form.

    Assay Conditions: Enzyme reaction is conducted using a PARP2 Assay Kit at room temperature for 1 hour.

  • Purity

    >= 12 % SDS-PAGE.

  • Expression system

    Baculovirus infected Sf9 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      AARRRRSTGGGRARALNESKRVNNGNTAPEDSSPAKKTRRCQRQESKKMP VAGGKANKDRTEDKQDGMPGRSWASKRVSESVKALLLKGKAPVDPECTAK VGKAHVYCEGNDVYDVMLNQTNLQFNNNKYYLIQLLEDDAQRNFSVWMRW GRVGKMGQHSLVACSGNLNKAKEIFQKKFLDKTKNNWEDREKFEKVPGKY DMLQMDYATNTQDEEETKKEESLKSPLKPESQLDLRVQELIKLICNVQAM EEMMMEMKYNTKKAPLGKLTVAQIKAGYQSLKKIEDCIRAGQHGRALMEA CNEFYTRIPHDFGLRTPPLIRTQKELSEKIQLLEALGDIEIAIKLVKTEL QSPEHPLDQHYRNLHCALRPLDHESYEFKVISQYLQSTHAPTHSDYTMTL LDLFEVEKDGEKEAFREDLHNRMLLWHGSRMSNWVGILSHGLRIAPPEAP ITGYMFGKGIYFADMSSKSANYCFASRLKNTGLLLLSEVALGQCNELLEA NPKAEGLLQGKHSTKGLGKMAPSSAHFVTLNGSTVPLGPASDTGILNPDG YTLNYNEYIVYNPNQVRMRYLLKVQFNFLQLW
    • Predicted molecular weight

      92 kDa including tags
    • Amino acids

      2 to 583
    • Tags

      GST tag N-Terminus
    • Additional sequence information

      NM_005484.

Associated products

Specifications

Our Abpromise guarantee covers the use of ab198766 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.63% Tris HCl, 0.64% Sodium chloride, 0.02% Potassium chloride, 0.49% Glutathione, 20% Glycerol, 0.05% DTT

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • ADP ribosyltransferase like 2
    • ADP-ribosyltransferase diphtheria toxin-like 2
    • ADPRT 2
    • ADPRT-2
    • ADPRT2
    • ADPRTL 2
    • ADPRTL 3
    • ADPRTL2
    • ADPRTL3
    • ARTD2
    • hPARP 2
    • hPARP-2
    • hPARP2
    • NAD(+) ADP ribosyltransferase 2
    • NAD(+) ADP-ribosyltransferase 2
    • pADPRT 2
    • pADPRT-2
    • pADPRT2
    • PARP 2
    • PARP-2
    • PARP2
    • PARP2_HUMAN
    • Poly (ADP ribose) polymerase family member 2
    • Poly (ADP ribosyl) transferase like 2
    • poly (ADP-ribose) polymerase 2
    • Poly [ADP ribose] synthetase 2
    • Poly [ADP-ribose] polymerase 2
    • Poly(ADP ribose) synthetase
    • Poly[ADP-ribose] synthase 2
    see all
  • Function

    Involved in the base excision repair (BER) pathway, by catalyzing the poly(ADP-ribosyl)ation of a limited number of acceptor proteins involved in chromatin architecture and in DNA metabolism. This modification follows DNA damages and appears as an obligatory step in a detection/signaling pathway leading to the reparation of DNA strand breaks.
  • Tissue specificity

    Widely expressed, mainly in actively dividing tissues. The highest levels are in the brain, heart, pancreas, skeletal muscle and testis; also detected in kidney, liver, lung, placenta, ovary and spleen; levels are low in leukocytes, colon, small intestine, prostate and thymus.
  • Sequence similarities

    Contains 1 PARP alpha-helical domain.
    Contains 1 PARP catalytic domain.
  • Post-translational
    modifications

    Poly-ADP-ribosylated by PARP1.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • Activity assay using ab198766.

  • 10% SDS-PAGE analysis of 2 µg ab198766 with Coomassie staining.

References

This product has been referenced in:

See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab198766.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up