Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSMATSPQKSPSVPKSPTPKSPPSRKKDD SFLGKLGGTLARRKKAKEVSELQEEGMNAINLPLSPIPFELDPEDTMLEE NEVRTMVDPNSRSDPKLQELMKVLIDWINDVLVGERIIVKDLAEDLYDGQ VLQKLFEKLESEKLNVAEVTQSEIAQKQKLQTVLEKINETLKLPPRSIKW NVDSVHAKSLVAILHLLVALSQYFRAPIRLPDHVSIQVVVVQKREGILQS RQIQEEITGNTEALSGRHERDAFDTLFDHAPDKLNVVKKTLITFVNKHLN KLNLEVTELETQFADGVYLVLLMGLLEGYFVPLHSFFLTPDSFEQKVLNV SFAFELMQDGGLEKPKPRPEDIVNCDLKSTLRVLYNLFTKYRNVE
    • Molecular weight

      45 kDa including tags
    • Amino acids

      1 to 372
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab134616 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry

    MALDI-TOF
  • Purity

    > 85 % SDS-PAGE.
    ab134616 is purified using conventional chromatography techniques.
  • Form

    Liquid
  • Additional notes

     This product was previously labelled as Parvin alpha

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.02% DTT, 0.32% Tris HCl, 10% Glycerol, 0.88% Sodium chloride

General Info

  • Alternative names

    • Actopaxin
    • Alpha parvin
    • Alpha-parvin
    • Calponin like integrin linked kinase binding protein
    • Calponin-like integrin-linked kinase-binding protein
    • CH ILKBP
    • CH-ILKBP
    • FLJ10793
    • FLJ12254
    • Matrix remodelling associated 2
    • Matrix remodelling associated protein 2
    • Matrix-remodeling-associated protein 2
    • MXRA 2
    • MXRA2
    • PARV A
    • Parva
    • PARVA_HUMAN
    see all
  • Function

    Probably plays a role in the regulation of cell adhesion and cytoskeleton organization. Plays a role in ciliogenesis.
  • Tissue specificity

    Widely expressed, with highest levels in heart, skeletal muscle, kidney and liver.
  • Sequence similarities

    Belongs to the parvin family.
    Contains 2 CH (calponin-homology) domains.
  • Cellular localization

    Cell junction > focal adhesion. Cell membrane. Cytoplasm > cytoskeleton. Constituent of focal adhesions.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab134616.

References

ab134616 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab134616.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up