Description

  • Product name

    Recombinant Human Parvalbumin protein
    See all Parvalbumin proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    ab101107 was purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSHMSMTDLLNAEDIKKAVGAFSATDSFD HKKFFQMVGLKKKSADDVKKVFHMLDKDKSGFIEEDELGFILKGFSPDAR DLSAKETKMLMAAGDKDGDGKIGVDEFSTLVAES
    • Predicted molecular weight

      15 kDa including tags
    • Amino acids

      1 to 110
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab101107 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.0154% DTT, 0.316% Tris HCl, 10% Glycerol, 0.29% Sodium chloride

General Info

  • Alternative names

    • D22S749
    • MGC116759
    • Parvalbumin alpha
    • PRVA_HUMAN
    • PVALB
    see all
  • Function

    In muscle, parvalbumin is thought to be involved in relaxation after contraction. It binds two calcium ions.
  • Sequence similarities

    Belongs to the parvalbumin family.
    Contains 2 EF-hand domains.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3µg ab101107

References

ab101107 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab101107.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up