Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MDMHCKADPFSAMHPGHGGVNQLGGVFVNGRPLPDVVRQRIVELAHQGVR PCDISRQLRVSHGCVSKILGRYYETGSIKPGVIGGSKPKVATPKVVDKIA EYKRQNPTMFAWEIRDRLLAEGICDNDTVPSVSSINRIIRTKVQQPFHPT PDGAGTGVTAPGHTIVPSTASPPVSSASNDPVGSYSINGILGIPRSNGEK RKRDEVEVYTDPAHIRGGGGLHLVWTLRDVSEGSVPNGDSQSGVDSLRKH LRADTFTQQQLEALDRVFERPSYPDVFQASEHIKSEQGNEYSLPALTPGL DEVKSSLSASTNPELGSNVSGTQTYPVVTGRDMASTTLPGYPPHVPPTGQ GSYPTSTLAGMVPGSEFSGNPYSHPQYTAYNEAWRFSNPALLMPPPGPPL PLLPLPMTATSYRGDHIKLQADSFGLHIVPV
    • Amino acids
      1 to 431
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159050 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FSGS7
    • Paired box 2
    • Paired box gene 2
    • paired box homeotic gene 2
    • paired box protein 2
    • Paired box protein Pax 2
    • Paired box protein Pax-2
    • Paired box protein Pax2
    • PAPRS
    • Pax 2
    see all
  • Relevance
    Pax2 is a transcription factor critically required during the development of the nervous and excretory systems, including the midbrain, hindbrain, spinal cord, eye, ear and urogenital tract. Like other products of the Pax gene family, Pax2 encodes a conserved 128 amino acid paired box DNA-binding domain in the N-terminal portion of the molecule. Function: Probable transcription factor that may have a role in kidney cell differentiation. Has a critical role in the development of the urogenital tract, the eyes, and the CNS. Tissue specificity: Expressed in primitive cells of the kidney, ureter, eye, ear and central nervous system.
  • Cellular localization
    Nuclear

Images

  • ab159050 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159050 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159050.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up