Description

  • Product name

    Recombinant Human PBX1/PRL protein
  • Expression system

    Wheat germ
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MQLKQSTCEAVMILRSRFLDARRKRRNFNKQATEILNEYFYSHLSNPYPS EEAKEELAKKCGITVSQVSNWFGNKRIRYKKNIGKFQEEANIYAAKTAVT ATNVSAHGS
    • Amino acids

      213 to 321
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159054 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as PBX1. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • DKFZp686B09108
    • Homeo box protein PBX1
    • Homeo box protein PRL
    • Homeobox protein PBX 1
    • Homeobox protein PBX1
    • Homeobox protein PRL
    • MGC126627
    • PBX 1
    • Pbx1
    • PBX1_HUMAN
    • Pre B cell leukemia homeobox 1
    • Pre B cell leukemia transcription factor 1
    • Pre-B-cell leukemia transcription factor 1
    • PRL
    see all
  • Function

    Binds the sequence 5'-ATCAATCAA-3'. Acts as a transcriptional activator of PF4 in complex with MEIS1. Converted into a potent transcriptional activator by the (1;19) translocation. May have a role in steroidogenesis and, subsequently, sexual development and differentiation.
  • Tissue specificity

    Expressed in all tissues except in cells of the B and T lineage.
  • Involvement in disease

    Note=A chromosomal aberration involving PBX1 is a cause of pre-B-cell acute lymphoblastic leukemia (B-ALL). Translocation t(1;19)(q23;p13.3) with TCF3. E2A-PBX1 transforms cells by constitutively activating transcription of genes regulated by PBX1 or by other members of the PBX protein family.
  • Sequence similarities

    Belongs to the TALE/PBX homeobox family.
    Contains 1 homeobox DNA-binding domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • ab159054 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159054 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159054.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up