Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MGWGSRCCCPGRLDLLCVLALLGGCLLPVCRTRVYTNHWAVKIAGGFPEA NRIASKYGFINIGQIGALKDYYHFYHSRTIKRSVISSRGTHSFISMEPKV EWIQQQVVKKRTKRDYDFSRAQSTYFNDPKWPSMWYMHCSDNTHPCQSDM NIEGAWKRGYTGKNIVVTILDDGIERTHPDLMQNYDALASCDVNGNDLDP MPRYDASNENKHGTRCAGEVAAAANNSHCTVGIAFNAKIGGVRMLDGDVT DMVEAKSVSFNPQHVHIYSASWGPDDDGKTVDGPAPLTRQAFENGVRMGR RGLGSVFVWASGNGGRSKDHCSCDGYTNSIYTISISSTAESGKKPWYLEE CSSTLATTYSSGESYDKKIITTDLRQRCTDNHTGTSASAPMAAGIIALAL EANPFLTWRDVQHVIVRTSRAGHLNANDWKTNAAGFKVSHLYGFGLMDAE AMVMEAEKWTTVPRQHVCVESTDRQIKTIRPNSAVRSIYKASGCSDNPNR HVNYLEHVVVRITITHPRRGDLAIYLTSPSGTRSQLLANRLFDHSMEGFK NWEFMTIHCWGERAAGDWVLEVYDTPSQLRNFKTPGKLKEWSLVLYGTSV QPYSPTNEFPKVERFRYSRVEDPTDDYGTEDYAGPCDPECSEVGCDGPGP DHCNDCLHYYYKLKNNTRICVSSCPPGHYHADKKRCRKCAPNCESCFGSH GDQCMSCKYGYFLNEETNSCVTHCPDGSYQDTKKNLCRKCSENCKTCTEF HNCTECRDGLSLQGSRCSVSCEDGRYFNGQDCQPCHRFCATCAGAGADGC INCTEGYFMEDGRCVQSCSISYYFDHSSENGYKSCKKCDISCLTCNGPGF KNCTSCPSGYLLDLGMCQMGAICKDATEESWAEGGFCMLVKKNNLCQRKV LQQLCCKTCTFQG
    • Molecular weight

      128 kDa including tags
    • Amino acids

      1 to 913

Associated products

Specifications

Our Abpromise guarantee covers the use of ab132450 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • FLJ11149
    • FLJ16215
    • hPC6
    • PC5
    • PC6
    • PC6A
    • Pcsk5
    • PCSK5_HUMAN
    • Prohormone convertase 5
    • Proprotein convertase 5
    • Proprotein convertase 6
    • Proprotein convertase PC5
    • Proprotein convertase subtilisin/kexin type 5
    • Protease PC6
    • SPC6
    • Subtilisin/kexin-like protease PC5
    see all
  • Function

    Likely to represent a widespread endoprotease activity within the constitutive and regulated secretory pathway. Capable of cleavage at the RX(K/R)R consensus motif.
  • Tissue specificity

    Expressed in T-lymphocytes.
  • Sequence similarities

    Belongs to the peptidase S8 family.
    Contains 1 homo B/P domain.
    Contains 1 PLAC domain.
  • Domain

    The propeptide domain acts as an intramolecular chaperone assisting the folding of the zymogen within the endoplasmic reticulum.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132450 stained with Coomassie Blue.

References

ab132450 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132450.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up