Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      VTIPYRPKPSSSPVIFAGGQDRYSTGSDSASFPHTTPSMCLNPDLEGPPL EAYTIQGQYAIPQPDLTKLHQLAMQQSHFPMTHGNTGFSGIESSSPEVKG YWAGLDASAQ
    • Amino acids

      174 to 283
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab152593 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Alpha CP2
    • Alpha-CP2
    • alphaCP-2
    • Cbp
    • CTBP
    • Heterogeneous nuclear ribonucleoprotein E2
    • Heterogenous nuclear ribonucleoprotein E2
    • hnRNP E2
    • hnRNP-E2
    • HNRNPE2
    • Hnrnpx
    • HNRPE2
    • Hnrpx
    • MGC110998
    • PCBP2
    • PCBP2_HUMAN
    • poly(rC) binding protein 2
    • Poly(rC)-binding protein 2
    • Putative heterogeneous nuclear ribonucleoprotein X
    • rCbinding protein 2
    see all
  • Function

    Single-stranded nucleic acid binding protein that binds preferentially to oligo dC. Major cellular poly(rC)-binding protein. Binds also poly(rU). Negatively regulates cellular antiviral responses mediated by MAVS signaling. It acts as an adapter between MAVS and the E3 ubiquitin ligase ITCH, therefore triggering MAVS ubiquitinationa and degradation.
  • Tissue specificity

    Detected in all tissues examined.
  • Sequence similarities

    Contains 3 KH domains.
  • Post-translational
    modifications

    Phosphorylated. The non-phosphorylated form(s) exhibited the strongest poly(rC)-binding activity.
  • Cellular localization

    Nucleus. Cytoplasm. Loosely bound in the nucleus. May shuttle between the nucleus and the cytoplasm.
  • Information by UniProt

Images

  • ab152593 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab152593 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152593.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up