Description

  • Product name

    Recombinant Human PCDH12 protein
  • Purity

    > 90 % SDS-PAGE.
    ab182818 was expressed in E.coli as inclusion bodies, refolded using a unique “temperature shift inclusion body refolding” technology and chromatographically purified.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MASMTGGQQMGRGHHHHHHGNLYFQGGEFQEVTTLTVKYQVSEEVPSGTV IGKLSQELGREERRRQAGAAFQVLQLPQALPIQVDSEEGLLSTGRRLDRE QLCRQWDPCLVSFDVLATGDLALIHVEIQVLDINDHQPRFPKGEQELEIS ESASLRTRIPLDRALDPDTGPNTLHTYTLSPSEHFALDVIVGPDETKHAE LIVVKELDREIHSFFDLVLTAYDNGNPPKSGTSLVKVNVLDSNDNSPAFA ESSLALEIQEDAAPGTLLIKLTATDPDQGPNGEVEFFLSKHMPPEVLDTF SIDAKTGQVILRRPLDYEKNPAYEVDVQARDLGPNPIPAHCKVLIKVLDV NDNIPSIHVTWASQPSLVSEALPKDSFIALVMADDLDSGNNGLVHCWLSQ ELGHFRLKRTNGNTYMLLTNATLDREQWPKYTLTLLAQDQGLQPLSAKKQ LSIQISDINDNAPVFEKSRYEVSTRENNLPSLHLITIKAHDADLGINGKV SYRIQDSPVAHLVAIDSNTGEVTAQRSLNYEEMAGFEFQVIAEDSGQPML ASSVSVWVSLLDANDNAPEVVQPVLSDGKASLSVLVNASTGHLLVPIETP NGLGPAGTDTPPLATHSSRPFLLTTIVARDADSGANGEPLYSIRSGNEAH LFILNPHTGQLFVNVTNASSLIGSEWELEIVVEDQGSPPLQTRALLRVMF VTSVDHLRDSARKPGALSMSMLT
    • Predicted molecular weight

      79 kDa including tags
    • Amino acids

      25 to 718
    • Additional sequence information

      Constructed with codon optimization and expressed with a small T7-His-TEV cleavage site tag (29aa) fusion at its N-terminal (NP_057664).

Specifications

Our Abpromise guarantee covers the use of ab182818 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Store at -80°C.

    pH: 8.0
    Constituent: 0.32% Tris HCl

    Contains NACl, EDTA, KCl, arginine, DTT and glycerol

General Info

  • Alternative names

    • PCD12_HUMAN
    • Pcdh12
    • Protocadherin 12
    • Protocadherin-12
    • Vascular cadherin 2
    • Vascular cadherin-2
    • Vascular endothelial cadherin 2
    • Vascular endothelial cadherin-2
    • VE cadherin 2
    • VE-cad-2
    • VE-cadherin-2
    • VECAD2
    see all
  • Function

    Cellular adhesion molecule that may play an important role in cell-cell interactions at interendothelial junctions. Promotes homotypic calcium dependent aggregation and adhesion and clusters at intercellular junctions. Unable to bind to catenins, weakly associates with the cytoskeleton.
  • Tissue specificity

    Expressed in highly vascularized tissues including the heart and placenta, but most tissues contain a low level of expression. Prominent expression in the spleen.
  • Sequence similarities

    Contains 6 cadherin domains.
  • Cellular localization

    Cell membrane. Cell junction.
  • Information by UniProt

References

ab182818 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab182818.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up