Overview

  • Product name

    Recombinant Human PCDH7 protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      KQLLRYRLAEEGPADVRIGNVASDLGIVTGSGEVTFSLESGSEYLKIDNL TGELSTSERRIDREKLPQCQMIFDENECFLDFEVSVIGPSQSWV
    • Molecular weight

      36 kDa including tags
    • Amino acids

      31 to 124

Specifications

Our Abpromise guarantee covers the use of ab116835 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • BH Pcdh
    • BH protocadherin
    • BH-Pcdh
    • BHPCDH
    • Brain heart protocadherin
    • Brain-heart protocadherin
    • PCDH 7
    • PCDH7
    • PCDH7_HUMAN
    • Protocadherin 7
    • Protocadherin-7
    see all
  • Tissue specificity

    Expressed predominantly in brain and heart and at lower levels in various other tissues.
  • Sequence similarities

    Contains 7 cadherin domains.
  • Post-translational
    modifications

    Isoform C is phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab116835 at approximately 35.97 kDa.

References

ab116835 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab116835.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up