Overview

  • Product name
    Recombinant Human PCDHA5 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      TNEEETNFLELVLRKSLDREETQEHRLLVIATDGGKPELTGTVQLLINVL DANDNAPEFDKSIYNVRLLENAPSGTLVIKLNASDADEGINKEIVYFFSN LVLDDVK
    • Amino acids
      183 to 289
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163342 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Cadherin related neuronal receptor 6
    • CNR 6
    • CNR6
    • CNRN 6
    • CNRN6
    • CNRS 6
    • CNRS6
    • CRNR 6
    • CRNR6
    • KIAA0345 like 9
    • Ortholog of mouse CNR6
    • PCDH alpha5
    • PCDHA 5
    • Protocadherin alpha 5
    see all
  • Relevance
    PCDHA5 (Protocadherin alpha 5) is a member of the protocadherin family, a subgroup of the cadherin superfamily. Protocadherins are neural cadherin like cell surface proteins which are present at synaptic junctions. Their specific functions are unknown but they most likely play a critical role in the establishment and function of specific neuronal connections in the brain. PCDHA5 is one of fifteen tandemly arranged genes within the alpha cluster of protocadherin genes on 5q31.
  • Cellular localization
    Cell membrane; Single pass type I membrane protein.

Images

  • ab163342 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163342 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163342.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up