Overview

  • Product name

    Recombinant Human PCDHA5 protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      TNEEETNFLELVLRKSLDREETQEHRLLVIATDGGKPELTGTVQLLINVL DANDNAPEFDKSIYNVRLLENAPSGTLVIKLNASDADEGINKEIVYFFSN LVLDDVK
    • Amino acids

      183 to 289
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163342 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Cadherin related neuronal receptor 6
    • CNR 6
    • CNR6
    • CNRN 6
    • CNRN6
    • CNRS 6
    • CNRS6
    • CRNR 6
    • CRNR6
    • KIAA0345 like 9
    • Ortholog of mouse CNR6
    • PCDH alpha5
    • PCDHA 5
    • Protocadherin alpha 5
    see all
  • Relevance

    PCDHA5 (Protocadherin alpha 5) is a member of the protocadherin family, a subgroup of the cadherin superfamily. Protocadherins are neural cadherin like cell surface proteins which are present at synaptic junctions. Their specific functions are unknown but they most likely play a critical role in the establishment and function of specific neuronal connections in the brain. PCDHA5 is one of fifteen tandemly arranged genes within the alpha cluster of protocadherin genes on 5q31.
  • Cellular localization

    Cell membrane; Single pass type I membrane protein.

Images

  • ab163342 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163342 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163342.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up