Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      HLGAPSPRYLELDLTSGALFVNERIDREALCEQRPRCLLSLEVLAHNPVA VSAVEVEILDINDNSPRFPRPNYQLQVSESVAPGARFHIESAQDPDVGAN SVQTYELSPS
    • Amino acids
      81 to 190
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163333 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • MGC71598
    • PCDH alpha C2
    • PCDH-ALPHA-C2
    • PCDHAC 2
    • Protocadherin alpha C2
    • Protocadherin alpha subfamily C 2
    • Protocadherin-alpha, subfamily C, member 2
    see all
  • Relevance
    PCDHAC2 (Protocadherin alpha C2) is a member of the protocadherin family, a subgroup of the cadherin superfamily. Protocadherins are neural cadherin-like cell adhesion proteins that are integral membrane proteins. Their specific functions are unknown but they most likely play a critical role in the establishment and function of specific neuronal connections in the brain. PCDHAC2 is one of fifteen tandemly arranged genes within the alpha cluster of protocadherin genes on 5q31.
  • Cellular localization
    Cell membrane. Single-pass type I membrane protein.

Images

  • ab163333 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163333 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163333.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up