Recombinant Human PCDHB15 protein (ab163323)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      ELRLTLTAVDGGSPPRSGTVQILILVLDANDNAPEFVQALYEVQVPENSP VGSLVVKVSARDLDTGTNGEISYSLYYSSQEIDKPFELSSLSGEIRLIKK
    • Amino acids
      207 to 306
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163323 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • PCDH beta15
    • PCDHB 15
    • Protocadherin beta 15
  • Relevance
    Protocadherin beta 15 (PCDHB15) is a member of the protocadherin family. Protocadherins constitute the largest subgroup within the cadherin family of calcium-dependent cell-cell adhesion molecules. They are neural cell surface proteins which are present at synaptic junctions. Their specific functions are unknown but they may be involved in the establishment and function of specific neuronal connections in the brain. PCDHB15 is one of sixteen tandemly arranged genes in the PCDHB gene cluster on chromosome 5q31.
  • Cellular localization
    Cell membrane; Single-pass type I membrane protein.

Images

  • ab163323 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163323 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163323.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up