Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      ASLRVRDINDHAPEFPAREMLLKISEITMPGKIFPLKMAHDLDTGSNGLQ RYTISSNPHFHVLTRNRSEGRKFPELVLDKPLDREEQPQLRLTLIALDGG
    • Amino acids
      118 to 217
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163329 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • PCDH beta6
    • PCDHB 6
    • Protocadherin beta 6
  • Relevance
    PCDHB6 (Protocadherin beta 6) is a member of the protocadherin family, a subgroup of the cadherin superfamily. Protocadherins are neural cadherin-like cell adhesion proteins that are integral membrane proteins. The specific function of PCDHB6 is unknown but it is thought to be involved in the establishment and maintenance of specific neuronal connections in the brain. PCDHB6 is a member of the beta cluster of protocadherin genes on 5q31.
  • Cellular localization
    Cell membrane. Single-pass type I membrane protein.

Images

  • ab163329 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163329 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163329.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up