Overview

  • Product name

    Recombinant Human PCGF1 protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MRLRNQLQSVYKMDPLRNEEEVRVKIKDLNEHIVCCLCAGYFVDATTITE CLHTFCKSCIVKYLQTSKYCPMCNIKIHETQPLLNLKLDRVMQDIVYKLV PGLQDSEEKRIREFYQSRGLDRVTQPTGEEPALSNLGLPFSSFDHSKAHY YRYDEQLNLCLERLSSGKDKNKSVLQNKYVRCSVRAEVRHLRRVLCHRLM LNPQHVQLLFDNEVLPDHMTMKQIWLSRWFGKPSPLLLQYSVKEKRR
    • Molecular weight

      56 kDa including tags
    • Amino acids

      13 to 259

Associated products

Specifications

Our Abpromise guarantee covers the use of ab132882 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • PCGF1
    • 2010002K04Rik
    • Lethal(3)73AH, Drosophila, homolog of
    • MGC10882
    • Nervous system Polycomb-1
    • NSPc1
    • polycomb group ring finger 1
    • Polycomb group RING finger protein 1
    • RING finger protein 68
    • RNF3A-2
    • RNF68
    see all
  • Relevance

    PCGF1 is a component of the Polycomb group (PcG) multiprotein BCOR complex, a complex required to maintain the transcriptionally repressive state of some genes, such as BCL6 and the cyclin-dependent kinase inhibitor, CDKN1A. It represses CDKN1A expression by binding to its promoter, and this repression is dependent on the retinoic acid response element (RARE element). PCGF1 als promotes cell cycle progression and also enhances cell proliferation, thus it may have a positive role in tumor cell growth.
  • Cellular localization

    Nuclear

Images

  • 12.5% SDS-PAGE analysis of ab132882 stained with Coomassie Blue.

References

ab132882 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132882.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up