Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MEGVAVVTAGSVGAAKTEGAAALPPPPPPPVSPPALTPAPAAGEEGPAPL SETGAPGCSGSRPPELEPERSLGRFRGRFEDEDEELEEEEELEEEEEEEE EDMSHFSLRLEGGRQDSEDEEERLINLSELTPYILCSICKGYLIDATTIT ECLHTFCKSCIVRHFYYSNRCPKCNIVVHQTQPLYNISANEGTGHFKPLE KKFVRVSGEATIGHVEKFLRRKMGLDPACQVDIICGDHLLEQYQTLREIR RAIGDAAMQDGLLVLHYGLVVSPLKIT
    • Molecular weight

      57 kDa including tags
    • Amino acids

      1 to 275

Specifications

Our Abpromise guarantee covers the use of ab132525 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.

     This product was previously labelled as RING6a

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • MBLR
    • Mel18 and Bmi1 like RING finger protein
    • Mel18 and Bmi1-like RING finger
    • Pcgf6
    • PCGF6_HUMAN
    • Polycomb group RING finger protein 6
    • RING finger protein 134
    • RNF134
    see all
  • Function

    Transcriptional repressor. May modulate the levels of histone H3K4Me3 by activating KDM5D histone demethylase.
  • Tissue specificity

    Ubiquitous.
  • Sequence similarities

    Contains 1 RING-type zinc finger.
  • Post-translational
    modifications

    Phosphorylated during mitosis. Phosphorylated on Ser-30 by CDK7 in vitro.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132525 stained with Coomassie Blue.

References

ab132525 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132525.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up