Description

  • Product name

    Recombinant Human PCID2 protein (denatured)
    See all PCID2 proteins and peptides
  • Purity

    > 85 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMAYKCQTVIVQSFLRAFQAHKEENWALPVM YAVALDLRVFANNADQQLVKKGKSKVGDMLEKAAELLMSCFRVCASDTRA GIEDSKKWGMLFLVNQLFKIYFKINKLHLCKPLIRAIDSSNLKDDYSTAQ RVTYKYYVGRKAMFDSDFKQAEEYLSFAFEHCHRSSQKNKRMILIYLLPV KMLLGHMPTVELLKKYHLMQFAEVTRAVSEGNLLLLHEALAKHEAFFIRC GIFLILEKLKIITYRNLFKKVYLLLKTHQLSLDAFLVALKFMQVEDVDID EVQCILANLIYMGHVKGYISHQHQKLVVSKQNPFPPLSTVC
    • Predicted molecular weight

      39 kDa including tags
    • Amino acids

      80 to 399
    • Tags

      His tag N-Terminus
    • Additional sequence information

      NP_060856
  • Description

    Recombinant Human PCID2 protein

Specifications

Our Abpromise guarantee covers the use of ab183221 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Constituents: 0.32% Tris HCl, 10% Glycerol, 2.4% Urea

General Info

  • Alternative names

    • CSN12 like protein
    • CSN12-like protein
    • DKFZp686C20226
    • F10
    • FLJ11305
    • FLJ99362
    • HT004
    • MGC16774
    • PCI domain containing 2
    • PCI domain containing protein 2
    • PCI domain-containing protein 2
    • PCID2
    • PCID2_HUMAN
    • RP11 - 98F14.6
    see all
  • Function

    Required for B-cell survival through the regulation of the expression of cell-cycle checkpoint MAD2L1 protein during B cell differentiation.
  • Sequence similarities

    Belongs to the CSN12 family.
    Contains 1 PCI domain.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab183221 (3μg).

References

ab183221 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab183221.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up