Overview

  • Product name

    Recombinant Human PCMTD1 protein (BSA and azide free)
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MGSSHHHHHH SSGLVPRGSH MGSMGGAVSAGEDNDDLIDNLKEAQYIRTERVEQAFRAIDRGDYYLEGYR DNAYKDLAWKHGNIHLSAPCIYSEVMEALKLQPGLSFLNLGSGTGYLSTM VGLILGPFGINHGIELHSDVVEYAKEKLESFIKNSDSFDKFEFCEPAFVV GNCLQIASDSHQYDRIYCGAGVQKDHENYMKILLKVGGILVMPIEDQLTQ IMRTGQNTWESKNILAVSFAPLV
    • Molecular weight

      27 kDa including tags
    • Amino acids

      1 to 220
    • Tags

      His tag N-Terminus
    • Additional sequence information

      (NP_443169)

Specifications

Our Abpromise guarantee covers the use of ab174387 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 95 % SDS-PAGE.
    ab174387 is purified using anion-exchange chromatography (DEAE sepharose resin) and gel-filtration chromatography (Sephacryl S-200) with 20 mM Tris pH 7.5, 2 mM EDTA.
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

General Info

  • Alternative names

    • PCMD1_HUMAN
    • PCMTD1
    • Protein L isoaspartate (D aspartate) O methyltransferase domain containing 1
    • Protein-L-isoaspartate O-methyltransferase domain-containing protein 1
  • Sequence similarities

    Belongs to the methyltransferase superfamily. L-isoaspartyl/D-aspartyl protein methyltransferase family.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • SDS-PAGE analysis PCMTD1 using 3 µg of ab174387 on a 15% gel.

References

ab174387 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab174387.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up