Description

  • Product name

    Recombinant Human PCPE-2 protein
  • Expression system

    Wheat germ
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      GNYCSSDFVLAGTVITTITRDGSLHATVSIINIYKEGNLAIQQAGKNMSA RLTVVCKQCPLLRRGLNYIIMGQVGEDGRGKIMPNSFIMMFKTKNQKLLD ALKNKQC
    • Amino acids

      309 to 415
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162017 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as PCOLE2. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 2400001O18Rik
    • MGC187469
    • PCOC2_HUMAN
    • PCOLCE 2
    • Pcolce2
    • PCOLE 2
    • PCOLE2
    • PCPE 2
    • PCPE-2
    • PCPE2
    • Procollagen C endopeptidase enhancer 2
    • Procollagen C proteinase enhancer 2
    • Procollagen C-endopeptidase enhancer 2
    • Procollagen C-proteinase enhancer 2
    • Procollagen COOH terminal proteinase enhancer 2
    • Procollagen COOH-terminal proteinase enhancer 2
    see all
  • Function

    Binds to the C-terminal propeptide of types I and II procollagens and may enhance the cleavage of that propeptide by BMP1.
  • Tissue specificity

    Highly expressed in the heart, trabecular meshwork, pituitary gland, bladder, mammary gland, trachea and placenta and weakly expressed in the brain. Expressed in cartilage.
  • Sequence similarities

    Contains 2 CUB domains.
    Contains 1 NTR domain.
  • Post-translational
    modifications

    O-glycosylated; contains sialic acid.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • ab162017 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162017 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162017.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up