Overview

  • Product name

    Recombinant Human PCPTP1/PTPRQ protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MRRAVCFPALCLLLNLHAAGCFSGNNDHFLAINQKKSGKPVFIYKHSQDI EKSLDIAPQKIYRHSYHSSSEAQVSKRHQIVNSAFPRPAYDPSLNLLAMD GQDLEVENLPIPAANVIVVTLQMDVNKLNITLLRIFRQGVAAALGLLPQQ VHINRLIGKKNSIELFVSPINRKTGISDALPSEEVLRSLNINVLHQSLSQ FGITEVSPEKNVLQGQHEADKIWSKEGFYAVVIFLSIFVIIVTCLMILYR LKERFQLSLRQDKEKNQEIHLSPITLQPALSEAKTVHSMVQPEQAPKVLN VVVDPQGRGAPEIRATTATSVCPSPFKMKPIGLQERRGSNVSLTLDMSSL GNIEPFVSIPTPREKVAMEYLQSASRILTRSQLRDVVASSHLLQSEFMEI PMNFVDPKEIDIPRHGTKNRYKTILPNPLSRVCLRPKNVTDSLSTYINAN YIRGYSGKEKAFIATQGPMINTVDDFWQMVWQEDSPVIVMITKLKEKNEK CVLYWPEKRGIYGKVEVLVISVNECDNYTIRNLVLKQGSHTQHVKHYWYT SWPDHKTPDSAQPLLQLMLDVEEDRLASQGRGPVVVHCSAGIGRTGCFIA TSIGCQQLKEEGVVDALSIVCQLRMDRGGMVQTSEQYEFVHHALCLYESR LSAETVQ
    • Molecular weight

      100 kDa including tags
    • Amino acids

      1 to 657

Associated products

Specifications

Our Abpromise guarantee covers the use of ab132435 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.

     This product was previously labelled as PCPTP1

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Ch-1PTPase
    • Ch1 PTPase
    • DKFZp781C1038
    • EC PTP
    • ECPTP
    • FLJ34328
    • MGC131968
    • MGC148170
    • NC PTPCOM1
    • NC-PTPCOM1
    • Protein tyrosine phosphatase Cr1PTPase precursor
    • Protein tyrosine phosphatase NC PTPCOM1
    • Protein tyrosine phosphatase PCPTP1
    • Protein tyrosine phosphatase receptor type R
    • Protein-tyrosine phosphatase PCPTP1
    • PTP SL
    • PTPBR7
    • PTPRQ
    • PTPRR
    • PTPRR_HUMAN
    • PTPSL
    • R-PTP-R
    • Receptor type tyrosine protein phosphatase R
    • Receptor-type tyrosine-protein phosphatase R
    see all
  • Function

    Sequesters mitogen-activated protein kinases (MAPKs) such as MAPK1, MAPK3 and MAPK14 in the cytoplasm in an inactive form. The MAPKs bind to a dephosphorylated kinase interacting motif, phosphorylation of which by the protein kinase A complex releases the MAPKs for activation and translocation into the nucleus.
  • Tissue specificity

    Expressed in brain, placenta, small intestine, stomach, uterus and weakly in the prostate. Isoform alpha has been observed only in the brain. Isoform gamma is expressed in brain, placenta and uterus. Isoform delta is expressed in brain, kidney, placenta, prostate, small intestine and uterus.
  • Sequence similarities

    Belongs to the protein-tyrosine phosphatase family. Receptor class 7 subfamily.
    Contains 1 tyrosine-protein phosphatase domain.
  • Cellular localization

    Cell membrane and Cytoplasm > perinuclear region. Locates to the perinuclear areas within the cytoplasm.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132435 stained with Coomassie Blue.

References

ab132435 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132435.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up