Bioactive grade

Recombinant human PCSK9 (mutated D374 Y) protein (Active) (Biotin) (ab246149)

Description

  • Product name

    Recombinant human PCSK9 (mutated D374 Y) protein (Active) (Biotin)
    See all PCSK9 proteins and peptides
  • Biological activity

    Immobilized Human LDL R, His Tag  at 10 μg/mL (100 μl/well) can bind ab246149 with a linear range of 0.02-0.5 μg/mL.

  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      QEDEDGDYEELVLALRSEEDGLAEAPEHGTTATFHRCAKDPWRLPGTYVV VLKEETHLSQSERTARRLQAQAARRGYLTKILHVFHGLLPGFLVKMSGDL LELALKLPHVDYIEEDSSVFAQSIPWNLERITPPRYRADEYQPPDGGSLV EVYLLDTSIQSDHREIEGRVMVTDFENVPEEDGTRFHRQASKCDSHGTHL AGVVSGRDAGVAKGASMRSLRVLNCQGKGTVSGTLIGLEFIRKSQLVQPV GPLVVLLPLAGGYSRVLNAACQRLARAGVVLVTAAGNFRDDACLYSPASA PEVITVGATNAQDQPVTLGTLGTNFGRCVDLFAPGEDIIGASSYCSTCFV SQSGTSQAAAHVAGIAAMMLSAEPELTLAELRQRLIHFSAKDVINEAWFP EDQRVLTPNLVAALPPSTHGAGWQLFCRTVWSAHSGPTRMATAVARCAPD EELLSCSSFSRSGKRRGERMEAQGGKLVCRAHNAFGGEGVYAIARCCLLP QANCSVHTAPPAEASMGTRVHCHQQGHVLTGCSSHWEVEDLGTHKPPVLR PRGQPNQCVGHREASIHASCCHAPGLECKVKEHGIPAPQEQVTVACEEGW TLTGCSALPGTSHVLGAYAVDNTCVVRSRDVSTTGSTSEGAVTAVAICCR SRHLAQASQELQ
    • Predicted molecular weight

      73 kDa including tags
    • Amino acids

      31 to 692
    • Modifications

      mutated D374 Y
    • Tags

      His tag C-Terminus , Avi tag C-Terminus
    • Additional sequence information

      The D374Y mutation results in higher affinity of PCSK9 for LDLR. Full length chain without signal peptide, without propeptide. Avitag™ sequence GLNDIFEAQKIEWHE.
  • Conjugation

    Biotin

Specifications

Our Abpromise guarantee covers the use of ab246149 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Lyophilised
  • Additional notes

    Biotinylation of this product is performed using Avitag™ technology. Briefly, the single lysine residue in the Avitag is enzymatically labeled with biotin.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon reconsitution add a carrier protein (0.1% BSA). Store at -20°C or -80°C. Avoid freeze / thaw cycle. Store In the Dark.

    pH: 7.40
    Constituents: PBS, 5% Trehalose

    0.22 µm filtered

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. . Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long-term storage.

General Info

  • Alternative names

    • Convertase subtilisin/kexin type 9 preproprotein
    • FH3
    • HCHOLA3
    • Hypercholesterolemia autosomal dominant 3
    • LDLCQ1
    • NARC 1
    • NARC-1
    • NARC1
    • Neural apoptosis regulated convertase 1
    • Neural apoptosis-regulated convertase 1
    • PC 9
    • PC9
    • PCSK 9
    • PCSK9
    • PCSK9_HUMAN
    • Proprotein convertase 9
    • Proprotein convertase PC9
    • Proprotein convertase subtilisin/kexin type 9
    • PSEC0052
    • Subtilisin/kexin like protease PC9
    • Subtilisin/kexin-like protease PC9
    see all
  • Function

    May be implicated in the differentiation of cortical neurons and may play a role in cholesterol homeostasis.
  • Tissue specificity

    Expressed in neuro-epithelioma, colon carcinoma, hepatic and pancreatic cell lines, and in Schwann cells.
  • Involvement in disease

    Defects in PCSK9 are the cause of familial hypercholesterolemia 3 (FH3) [MIM:603776]. FH3 inheritance is autosomal dominant.
  • Sequence similarities

    Belongs to the peptidase S8 family.
    Contains 1 peptidase S8 domain.
  • Post-translational
    modifications

    The soluble zymogen undergoes autocatalytic intramolecular processing in the endoplasmic reticulum, resulting in the cleavage of its propeptide that remains associated with the secreted enzyme.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab246149 under reducing conditions.

    The protein migrates as 16 kDa,18 kDa and 65 kDa on a SDS-PAGE gel under reducing conditions due to glycosylation and proteolytic digestion.

     

  • Immobilized Human LDL R, His Tag  at 10 μg/mL (100 μl/well) can bind ab246149 with a linear range of 0.02-0.5 μg/mL.

References

ab246149 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab246149.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up