Description

  • Product name

    Recombinant human PCSK9 protein
    See all PCSK9 proteins and peptides
  • Biological activity

    50 µL reaction mix (50 mM HEPES pH 7.4, 100 mM NaCl, 200 µM CaCl2, 0.05% Tween-20, 0.1% BSA, and up to 1500 ng PCSK9) is added to wells precoated with LDLR Ectodomain. Incubate for 2 hour. Add antibody against polyhistidine and then incubate 1 hour. Add secondary HRP labeled antibody and incubate 30 minutes. Finally, add HRP chemiluminescent substrates and read luminescence.

  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      QEDEDGDYEELVLALRSEEDGLAEAPEHGTTATFHRCAKDPWRLPGTYVV VLKEETHLSQSERTARRLQAQAARRGYLTKILHVFHGLLPGFLVKMSGDL LELALKLPHVDYIEEDSSVFAQSIPWNLERITPPRYRADEYQPPDGGSLV EVYLLDTSIQSDHREIEGRVMVTDFENVPEEDGTRFHRQASKCDSHGTHL AGVVSGRDAGVAKGASMRSLRVLNCQGKGTVSGTLIGLEFIRKSQLVQPV GPLVVLLPLAGGYSRVLNAACQRLARAGVVLVTAAGNFRDDACLYSPASA PEVITVGATNAQDQPVTLGTLGTNFGRCVDLFAPGEDIIGASSDCSTCFV SQSGTSQAAAHVAGIAAMMLSAEPELTLAELRQRLIHFSAKDVINEAWFP EDQRVLTPNLVAALPPSTHGAGWQLFCRTVWSAHSGPTRMATAVARCAPD EELLSCSSFSRSGKRRGERMEAQGGKLVCRAHNAFGGEGVYAIARCCLLP QANCSVHTAPPAEASMGTRVHCHQQGHVLTGCSSHWEVEDLGTHKPPVLR PRGQPNQCVGHREASIHASCCHAPGLECKVKEHGIPAPQEQVTVACEEGW TLTGCSALPGTSHVLGAYAVDNTCVVRSRDVSTTGSTSEGAVTAVAICCR SRHLAQASQELQHHHHHH
    • Predicted molecular weight

      72 kDa including tags
    • Amino acids

      31 to 692
    • Tags

      His tag C-Terminus
    • Additional sequence information

      Full length mature form with propeptide, without signal peptide.

Specifications

Our Abpromise guarantee covers the use of ab198471 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.63% Tris HCl, 0.64% Sodium chloride, 0.02% Potassium chloride, 20% Glycerol

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • Convertase subtilisin/kexin type 9 preproprotein
    • FH3
    • HCHOLA3
    • Hypercholesterolemia autosomal dominant 3
    • LDLCQ1
    • NARC 1
    • NARC-1
    • NARC1
    • Neural apoptosis regulated convertase 1
    • Neural apoptosis-regulated convertase 1
    • PC 9
    • PC9
    • PCSK 9
    • PCSK9
    • PCSK9_HUMAN
    • Proprotein convertase 9
    • Proprotein convertase PC9
    • Proprotein convertase subtilisin/kexin type 9
    • PSEC0052
    • Subtilisin/kexin like protease PC9
    • Subtilisin/kexin-like protease PC9
    see all
  • Function

    May be implicated in the differentiation of cortical neurons and may play a role in cholesterol homeostasis.
  • Tissue specificity

    Expressed in neuro-epithelioma, colon carcinoma, hepatic and pancreatic cell lines, and in Schwann cells.
  • Involvement in disease

    Defects in PCSK9 are the cause of familial hypercholesterolemia 3 (FH3) [MIM:603776]. FH3 inheritance is autosomal dominant.
  • Sequence similarities

    Belongs to the peptidase S8 family.
    Contains 1 peptidase S8 domain.
  • Post-translational
    modifications

    The soluble zymogen undergoes autocatalytic intramolecular processing in the endoplasmic reticulum, resulting in the cleavage of its propeptide that remains associated with the secreted enzyme.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • 4-20% SDS PAGE gel analysis of 2.3 μg ab198471 and stained with Coomassie.

    Product is autocleaved to the ~14 kDa prodomain (a.a. 31-152) and the ~58 kDa mature form (a.a. 153-692(end)), which run at higher apparent MW by SDS-PAGE.

  • Functional assay showing ab198471 interaction with LDLR

References

ab198471 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab198471.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up